DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS15 and Slc17a3

DIOPT Version :9

Sequence 1:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_598830.2 Gene:Slc17a3 / 105355 MGIID:2389216 Length:498 Species:Mus musculus


Alignment Length:458 Identity:141/458 - (30%)
Similarity:212/458 - (46%) Gaps:50/458 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSVAIVAM---TDR----NASNPDFPE-------------------FDWNESTKSYLLSSFFWGY 86
            :|:.:|||   ||.    |:|....|.                   ::|:..|:..:.||..:|.
Mouse    59 ISITMVAMVNNTDHPPHLNSSTEQLPAGLSGDQHEASKHLPIKAPVYNWSPQTQGIIFSSVQYGM 123

  Fly    87 VVTQIPGGYLSAIYGAKYMLFYGVLICSCLALLTPFCAVNGGWTVVVVLRAVQGLCQGVIFPSTH 151
            ::.|.|||||:...|.|.::...:|..|.|.|..|. |.|.|....:..||||||.||..:....
Mouse   124 ILMQGPGGYLAGKIGTKKVVGIALLGSSLLTLCIPL-AANLGLVFFLATRAVQGLMQGTGYGGQF 187

  Fly   152 TFLSKWAPAEERGRLVGYTYSGSQFGTVVMLSVSGYIASSSLGWPSTFYIPGCVGIVWSFVWLYL 216
            ....||||..||.||.....||...|...:|.|.| |.|.:||||..||..|..|::.|.:|..|
Mouse   188 ALWQKWAPPNERSRLCTIALSGMTLGIFTVLLVGG-IISEALGWPFVFYSFGGGGVLCSLLWFIL 251

  Fly   217 CSSTPAQHPTITPNERRFIESSGQARRPSDAGREEQPRPPTPWWRIFTSVPFLVLVLAHCANNWG 281
            ....|..||.|:..||.:|.||...:..|    ||||.|..   .:..|:|...:.|....:.|.
Mouse   252 IYDDPVSHPWISGPEREYILSSLNQQFSS----EEQPLPIK---AMLKSLPLWSMCLCTMTHQWL 309

  Fly   282 FWTLLTEIPTFMKNVLGMDIKNNGPLSALPYFAMILLTCVFIWLSDTLKQRG----TVIPLGFSR 342
            ..|.:...||::.:|..::|::||.||:||:....:|..:..||:|.|..:.    ||      |
Mouse   310 VNTFIMYTPTYISSVFKVNIRDNGFLSSLPFIVAWVLGILGGWLADFLLSKNFRLITV------R 368

  Fly   343 KFFNTLGMWLPMLALIGLGYITEGEANVRLAIGLLTAAVATNSATYLGFHVNHIDLSPNYAGTLM 407
            ||...||...|...:..|.||   :::....|..||.:......:..|.::|.:|::|.||..||
Mouse   369 KFITLLGNAPPAALVAALPYI---QSSYITTIIFLTISCGLCPLSQAGIYINALDIAPRYASFLM 430

  Fly   408 GITNCAANFMSILAPLIVGLIVWDETNPAQWRIVFFFTAFVYFIGNLLFMLFGRTRVQPW-NSRP 471
            |.:...|:..::|.|::.|..: .:.:...||..||....|..:|.:::::||:..||.| ..|.
Mouse   431 GTSRGLAHSSAVLVPIVAGFFL-SQDSEFGWRNFFFVVFAVNLLGLIIYLVFGKADVQEWARERK 494

  Fly   472 TTR 474
            .||
Mouse   495 LTR 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 138/451 (31%)
MFS 31..459 CDD:119392 133/440 (30%)
Slc17a3NP_598830.2 MFS_SLC17 42..482 CDD:340876 133/441 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.