DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS15 and SLC17A2

DIOPT Version :9

Sequence 1:NP_611375.2 Gene:MFS15 / 37168 FlyBaseID:FBgn0034392 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens


Alignment Length:482 Identity:156/482 - (32%)
Similarity:246/482 - (51%) Gaps:42/482 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GPRF-GVRHLQCILVFFGLAVAYSLRVNLSVAIVAMTDR-------------------NASNPDF 65
            ||.| .:|:...:::.|......:.||:||:||:||.:.                   |.|:...
Human    10 GPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTEGPVADAFNNSSISI 74

  Fly    66 PEFD-------WNESTKSYLLSSFFWGYVVTQIPGGYLSAIYGAKYMLFYGVLICSCLALLTPFC 123
            .|||       |:..|:..:.||..:|.::|.||.|||:.|:|||.||..|:||.|.|.|.||. 
Human    75 KEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLISSLLTLFTPL- 138

  Fly   124 AVNGGWTVVVVLRAVQGLCQGVIFPSTHTFLSKWAPAEERGRLVGYTYSGSQFGTVVMLSVSGYI 188
            |.:.|..:|:::|.|||:.||:.:....|..:||||..||.:|.....|||.||:.::|.|.|.|
Human   139 AADFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGLI 203

  Fly   189 ASSSLGWPSTFYIPGCVGIVWSFVWLYLCSSTPAQHPTITPNERRFIESSGQARRPSDAGREEQP 253
             |.:|.||..|||.|..|.|...:|..:....|..||.|:..|:..|.|| .|::||..||    
Human   204 -SQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSS-LAQQPSSPGR---- 262

  Fly   254 RPPTPWWRIFTSVPFLVLVLAHCANNWGFWTLLTEIPTFMKNVLGMDIKNNGPLSALPYFAMILL 318
              ..|...:.|.:|...:.|...::.|....:||.:||::..:|.::|:::|.||:||:.|....
Human   263 --AVPIKAMVTCLPLWAIFLGFFSHFWLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIAAASC 325

  Fly   319 TCVFIWLSDTLKQRGTVIPLGFSRKFFNTLGMWLPMLALIGLGYITEGEANVRLAIGLLTAAVAT 383
            |.:...|:|.|..| .::.|...||.|::||:.||.:..:.|.::.   ::..:.|.||.....|
Human   326 TILGGQLADFLLSR-NLLRLITVRKLFSSLGLLLPSICAVALPFVA---SSYVITIILLILIPGT 386

  Fly   384 NSATYLGFHVNHIDLSPNYAGTLMGITNCAANFMSILAPLIVGLIVWDETNPAQWRIVFFFTAFV 448
            ::....||.:|.:|::|.||..||||:........|::....|.:: .:...:.||.|||.:|.|
Human   387 SNLCDSGFIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLI-SQDFESGWRNVFFLSAAV 450

  Fly   449 YFIGNLLFMLFGRTRVQPW-NSRPTTR 474
            ...|.:.::.||:..:|.| ..|..||
Human   451 NMFGLVFYLTFGQAELQDWAKERTLTR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS15NP_611375.2 2A0114euk 18..469 CDD:129972 153/475 (32%)
MFS 31..459 CDD:119392 145/453 (32%)
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 154/480 (32%)
MFS 81..461 CDD:119392 131/393 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.