DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15093 and AT1G71180

DIOPT Version :9

Sequence 1:NP_001188972.1 Gene:CG15093 / 37166 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_565014.1 Gene:AT1G71180 / 843458 AraportID:AT1G71180 Length:318 Species:Arabidopsis thaliana


Alignment Length:294 Identity:79/294 - (26%)
Similarity:143/294 - (48%) Gaps:22/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IGFVGLGNMGANMASNLIKAGHKLHVF--DISKPACDGLAAKGATVYAKTSELAKNSDFVITMLP 93
            ||::|:|.||:.|.|::|.||:.:.|:  |:.|  ...|..|||.:.....|||:.||.|.|::.
plant    37 IGWIGIGIMGSAMVSHIIAAGYSVTVYARDLRK--TKDLQTKGARIANSPKELAEMSDVVFTIVG 99

  Fly    94 NNAIVDASY--DEMTADGVNKDTIFIDSSTISPDLVKSLQKKISAKGARFIDAPVSGGVPGAEQA 156
            |...|.:..  |:....|:....:.:|.::..|.|.:.:..:...:....:|||||||..||.:.
plant   100 NFNDVRSLLLGDDGVLSGLTPGGVTVDMTSSKPGLAREIHAEARRRNCWAVDAPVSGGDAGAREG 164

  Fly   157 TLTFMVGGTEAEYNAVKAVLECMGKKITHCGVYGMGQAAKLCNNMMLAISMIGVSEAMNLAVRQG 221
            ||....||.......:..|::.:| .:|:.|..|.||:.|:.|.:..|.:::|::|.:..|.:.|
plant   165 TLGIFAGGDSEIVEWLSPVMKNIG-TVTYMGEAGSGQSCKIGNQIAGASNLVGLAEGIVFAEKAG 228

  Fly   222 LDANVFAEIINSSTGRCWASEIYNPVPGVCPSAPANRDY-AGGFSSALITKDLGLASGVANASNS 285
            ||...:.|.:...........::..:       ...||| |.||:..:: ||||:|:..|     
plant   229 LDTVKWLEAVKDGAAGSAVMRLFGEM-------IVKRDYRATGFAEYMV-KDLGMAAEAA----- 280

  Fly   286 PIPLGSLAHKVYQSLCDKGLGNKDFSVVYDLMKK 319
             :|..:|:.:::..:...|.|......|..::::
plant   281 -MPGAALSKQLFTGMVANGDGKLGIQGVVSVIRR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 48/159 (30%)
HIBADH 33..318 CDD:130753 77/289 (27%)
NAD_binding_11 190..314 CDD:291499 29/124 (23%)
AT1G71180NP_565014.1 NAD_binding_2 43..195 CDD:281445 45/154 (29%)
MmsB 47..312 CDD:224995 73/281 (26%)
NAD_binding_11 197..>274 CDD:291499 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D812358at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1549
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.