DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15093 and AT1G71170

DIOPT Version :9

Sequence 1:NP_001188972.1 Gene:CG15093 / 37166 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_565013.2 Gene:AT1G71170 / 843457 AraportID:AT1G71170 Length:299 Species:Arabidopsis thaliana


Alignment Length:294 Identity:81/294 - (27%)
Similarity:142/294 - (48%) Gaps:20/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IGFVGLGNMGANMASNLIKAGHKLHVF--DISKPACDGLAAKGATVYAKTSELAKNSDFVITMLP 93
            ||::|:|.||:.|.|:::.||:.:.|:  |:.|  ...|..||........||.:.||.|.|::.
plant    16 IGWIGIGIMGSAMVSHILAAGYSVTVYARDLRK--TKDLQTKGGRTANSPKELGEMSDVVFTIVG 78

  Fly    94 NNAIVDASY--DEMTADGVNKDTIFIDSSTISPDLVKSLQKKISAKGARFIDAPVSGGVPGAEQA 156
            |:..|.:..  |:....|:....:.:|.::..|.|.:.:..:...:....:|||||||..||.:.
plant    79 NSNDVRSLLLGDDGVLSGLKPGGVTVDMTSSKPGLAREIYAEARRRDCWAVDAPVSGGDAGAREG 143

  Fly   157 TLTFMVGGTEAEYNAVKAVLECMGKKITHCGVYGMGQAAKLCNNMMLAISMIGVSEAMNLAVRQG 221
            .||...||.......:..|::.|| .:...|..|.||:.|:.|.:.:..:|||::|.:..|.:.|
plant   144 KLTIFAGGDSEIVEWLAPVMKTMG-IVRFMGGAGSGQSCKIGNQICVGSNMIGLAEGIVFAEKAG 207

  Fly   222 LDANVFAEIINSSTGRCWASEIYNPVPGVCPSAPANRDY-AGGFSSALITKDLGLASGVANASNS 285
            ||...:.|.:...........::..:..|       ||| |.||:..:: ||||:|:..|.|   
plant   208 LDPVKWLEAVKDGAAGSAVMRLFGEMMAV-------RDYKATGFAEYMV-KDLGMAAEAAMA--- 261

  Fly   286 PIPLGSLAHKVYQSLCDKGLGNKDFSVVYDLMKK 319
             :|..:|..:::..:...|.|...|..|.|::::
plant   262 -MPGTALNKQLFTVMVANGDGKLGFQGVVDVIRR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 45/159 (28%)
HIBADH 33..318 CDD:130753 79/289 (27%)
NAD_binding_11 190..314 CDD:291499 33/124 (27%)
AT1G71170NP_565013.2 MmsB 26..293 CDD:224995 75/281 (27%)
NAD_binding_2 26..174 CDD:281445 39/150 (26%)
NAD_binding_11 176..292 CDD:291499 35/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D812358at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1549
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.