DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15093 and GLYR2

DIOPT Version :9

Sequence 1:NP_001188972.1 Gene:CG15093 / 37166 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_564030.2 Gene:GLYR2 / 838342 AraportID:AT1G17650 Length:358 Species:Arabidopsis thaliana


Alignment Length:301 Identity:96/301 - (31%)
Similarity:147/301 - (48%) Gaps:17/301 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GAKNIGFVGLGNMGANMASNLIKAGHKLHVFDISKPACDGLAAKGATVYAKTSELAKNSDFVITM 91
            |..:|||:|:|.||:.||.||||||..:.|::.:|..||.|...||...:...|:....|....|
plant    65 GTVSIGFLGMGIMGSPMAQNLIKAGCDVTVWNRTKSKCDPLVGLGAKYKSSPEEVTATCDLTFAM 129

  Fly    92 L--PNNAIVDASYDEMTADGVNKDTIFIDSSTISPDLVKS--LQKKISAKGARFIDAPVSGGVPG 152
            |  |.:||..|........|::....::|.||:  |:..|  :.|:|...||.|::|||||....
plant   130 LADPESAIDVACGKNGAIFGISSGKGYVDVSTV--DVASSILISKQIKDTGALFLEAPVSGSKKP 192

  Fly   153 AEQATLTFMVGGTEAEYNAVKAVLECMGKKITHCGVYGMGQAAKLCNNMMLAISMIGVSEAMNLA 217
            ||...|.|:..|.:..|......|:.|||...:.|..|.|.|.||..||::...|...:|.:.|:
plant   193 AEDGQLIFLTAGDKPLYEKAAPFLDIMGKSKFYLGEVGNGAAMKLVVNMIMGSMMASFAEGILLS 257

  Fly   218 VRQGLDANVFAEIINSSTGRCWASEIYNP--VPGVCPSAPANRDYAGGFSSALITKDLGLASGVA 280
            .:.|||.||..|:::..........:..|  :..|.|:|         |......||:.||.|:|
plant   258 QKVGLDPNVLVEVVSQGAINAPMYSLKGPSMIKSVYPTA---------FPLKHQQKDMRLALGLA 313

  Fly   281 NASNSPIPLGSLAHKVYQSLCDKGLGNKDFSVVYDLMKKEK 321
            .:.:...|:.:.|:::|:.....||.::|||.|.:.:|..|
plant   314 ESVSQSTPIAAAANELYKVAKSYGLSDEDFSAVIEALKAAK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 56/161 (35%)
HIBADH 33..318 CDD:130753 91/290 (31%)
NAD_binding_11 190..314 CDD:291499 35/125 (28%)
GLYR2NP_564030.2 MmsB 68..351 CDD:224995 93/293 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D812358at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.