DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15093 and AT4G29120

DIOPT Version :9

Sequence 1:NP_001188972.1 Gene:CG15093 / 37166 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_194641.1 Gene:AT4G29120 / 829033 AraportID:AT4G29120 Length:334 Species:Arabidopsis thaliana


Alignment Length:332 Identity:96/332 - (28%)
Similarity:156/332 - (46%) Gaps:25/332 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVMSPAMLNAW-------SQTLVRAMSTQGGAKNIGFVGLGNMGANMASNLIKAGHKLHVFDISK 61
            |..||::::::       |.|:...:.|....| ||::|.|.||.:|..:|||||:.:.||:.:.
plant     7 RFPSPSVVSSFFLRRSMASSTISSDIITPSNTK-IGWIGTGVMGRSMCGHLIKAGYTVTVFNRTI 70

  Fly    62 PACDGLAAKGATVYAKTSELAKNSDFVITML--PN---NAIVDASYDEMTADGVNKDTIFIDSST 121
            .....|...||.|....:.:|:.||.|.|::  |:   :.::|.....::  |:.:..:.:|.:|
plant    71 SKAQTLIDMGANVADSPNSVAEQSDVVFTIVGYPSDVRHVLLDPKSGALS--GLRQGGVLVDMTT 133

  Fly   122 ISPDLVKSLQKKISAKGARFIDAPVSGGVPGAEQATLTFMVGGTEAEYNAVKAVLECMGKKITHC 186
            ..|.|.:.:.|..|.|....||||||||..||:...|:...||.|.....:..:...|| |:...
plant   134 SEPSLAEEIAKAASFKNCFSIDAPVSGGDLGAKNGKLSIFAGGDETTVKRLDPLFSLMG-KVNFM 197

  Fly   187 GVYGMGQAAKLCNNMMLAISMIGVSEAMNLAVRQGLDANVFAEIINSSTGRCWASEIYNPVPGVC 251
            |..|.||.|||.|.:.:|.:|:|:.|.:..|.:.|||...|.|.|::......:.::|.      
plant   198 GTSGKGQFAKLANQITIASTMLGLVEGLIYAHKAGLDVKKFLEAISTGAAGSKSIDLYG------ 256

  Fly   252 PSAPANRDYAGGFSSALITKDLGLASGVANASNSPIPLGSLAHKVYQSLCDKGLGNKDFSVVYDL 316
             .....||:..||......||||:...........:|..:||.::|.||  |..|..|......|
plant   257 -DRILKRDFDPGFYVNHFVKDLGICLNECQRMGLALPGLALAQQLYLSL--KAHGEGDLGTQALL 318

  Fly   317 MKKEKFS 323
            :..|:.:
plant   319 LALERLN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 51/162 (31%)
HIBADH 33..318 CDD:130753 86/289 (30%)
NAD_binding_11 190..314 CDD:291499 36/123 (29%)
AT4G29120NP_194641.1 MmsB 38..322 CDD:224995 89/296 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D812358at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1549
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.