DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15093 and hibadh

DIOPT Version :9

Sequence 1:NP_001188972.1 Gene:CG15093 / 37166 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001025604.1 Gene:hibadh / 594992 XenbaseID:XB-GENE-950889 Length:328 Species:Xenopus tropicalis


Alignment Length:293 Identity:145/293 - (49%)
Similarity:193/293 - (65%) Gaps:2/293 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IGFVGLGNMGANMASNLIKAGHKLHVFDISKPACDGLAAKGATVYAKTSELAKNSDFVITMLPN- 94
            :|||||||||..||.||:|.|:.:..||:...||......||.:....:::|:.:|.:|||||: 
 Frog    35 VGFVGLGNMGNPMAKNLLKHGYPVVAFDVFPEACKDFQDSGAQIMDSPADVAEKADRIITMLPSS 99

  Fly    95 -NAIVDASYDEMTADGVNKDTIFIDSSTISPDLVKSLQKKISAKGARFIDAPVSGGVPGAEQATL 158
             |||...:........|.|.::.||||||.|.:.|.|.|.:...||.|:||||||||..|....|
 Frog   100 ANAIEVYTGSNGILKKVKKGSLLIDSSTIDPAVSKELAKAVEKMGAVFMDAPVSGGVGAARSGNL 164

  Fly   159 TFMVGGTEAEYNAVKAVLECMGKKITHCGVYGMGQAAKLCNNMMLAISMIGVSEAMNLAVRQGLD 223
            ||||||.|.|::|.|.:|.|||..:.:||..|.|||||:||||:|||||||.||.|||.:|.|||
 Frog   165 TFMVGGVEQEFDAAKELLSCMGANVVYCGAVGTGQAAKICNNMLLAISMIGTSETMNLGIRLGLD 229

  Fly   224 ANVFAEIINSSTGRCWASEIYNPVPGVCPSAPANRDYAGGFSSALITKDLGLASGVANASNSPIP 288
            ..:.|:|:|.|:||||:|:.|||||||....|:..:|.|||.:.|:.||||||...|..:.||.|
 Frog   230 PKLLAKILNMSSGRCWSSDTYNPVPGVMEGVPSANNYQGGFGTTLMAKDLGLAQDSATNTKSPTP 294

  Fly   289 LGSLAHKVYQSLCDKGLGNKDFSVVYDLMKKEK 321
            ||||||::|:.:|.||...||||.|:..:::::
 Frog   295 LGSLAHQIYRVMCAKGYAQKDFSSVFQFLREDE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 70/157 (45%)
HIBADH 33..318 CDD:130753 144/286 (50%)
NAD_binding_11 190..314 CDD:291499 72/123 (59%)
hibadhNP_001025604.1 HIBADH 37..324 CDD:130753 144/286 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 158 1.000 Domainoid score I4053
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H15088
Inparanoid 1 1.050 294 1.000 Inparanoid score I2713
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524012at33208
OrthoFinder 1 1.000 - - FOG0003551
OrthoInspector 1 1.000 - - oto103700
Panther 1 1.100 - - LDO PTHR22981
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2375
SonicParanoid 1 1.000 - - X1549
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.