DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15093 and Ndf

DIOPT Version :9

Sequence 1:NP_001188972.1 Gene:CG15093 / 37166 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001188767.1 Gene:Ndf / 192507 FlyBaseID:FBgn0043456 Length:603 Species:Drosophila melanogaster


Alignment Length:301 Identity:68/301 - (22%)
Similarity:132/301 - (43%) Gaps:33/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KNIGFVGLGNMGANMASNLIKAGHKLHVFDISKPACDGLAAKGATVYAKTSELAKNSDFVITML- 92
            :..||:|||.||:.:..:||..|||:.|::.:...|...|..||.|.....::.:.:|.:...: 
  Fly   316 QTFGFLGLGMMGSTIVKDLIYTGHKVVVWNRTIDKCQPFAEAGAEVKDTPMDVVEAADVIFCCVS 380

  Fly    93 -PNNA--IVDASYDEMTADGVNKDTIFIDSSTISPDLVKSLQKKISAKGARFIDAPVSGGVPGAE 154
             |..|  :|..:...:....:| :..:::.|||.||....:.:.|.....|:::|.:.|....|.
  Fly   381 DPKGAKDLVFGNCGVLQLKDLN-NKAYVEMSTIDPDTSLDIGEGIKQCNGRYLEAQIHGSRQEAA 444

  Fly   155 QATLTFMVGGTEAEYNAVKAVLECMGKKITHCGVYGMGQAAK--LCNNMMLAISMIGVSEAMNLA 217
            :..|..:.||..:.:....:..:.:.|.....|. .:|.|.|  |....:|.:|::|::||:.||
  Fly   445 EGMLIILAGGDRSVFEECHSCFKTIAKNTFFLGT-DIGNACKVNLILQTILGVSLVGLAEALALA 508

  Fly   218 VRQGLDANVFAEIINSST---------GRCWASEIYNPVPGVCPSAPANRDYAGGFSSALITKDL 273
            .|..:..|...:|.:.::         |:..|...:|      |..|.:.          :.:||
  Fly   509 DRFSISLNDIIDIFDLTSMKSPMLLAKGKEMAKGDFN------PQQPLSH----------MQRDL 557

  Fly   274 GLASGVANASNSPIPLGSLAHKVYQSLCDKGLGNKDFSVVY 314
            .|...:|...:..:|:.|:.::|::.....|....|.|.|:
  Fly   558 RLVLNMAENLDQSMPVTSITNEVFKHTKRLGYSEHDSSAVF 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 37/161 (23%)
HIBADH 33..318 CDD:130753 67/297 (23%)
NAD_binding_11 190..314 CDD:291499 29/134 (22%)
NdfNP_001188767.1 N_Pac_NP60 20..106 CDD:99897
NAD_binding_2 316..477 CDD:281445 37/161 (23%)
MmsB 319..597 CDD:224995 67/295 (23%)
NAD_binding_11 481..597 CDD:291499 29/131 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445024
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.