DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mctp and AT1G73580

DIOPT Version :9

Sequence 1:NP_001261078.1 Gene:Mctp / 37165 FlyBaseID:FBgn0034389 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_177499.1 Gene:AT1G73580 / 843692 AraportID:AT1G73580 Length:168 Species:Arabidopsis thaliana


Alignment Length:142 Identity:45/142 - (31%)
Similarity:72/142 - (50%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 LRVHLKSGSDLVAMDKNGLSDPYVKFKVGGRLLHKSRTIHRDLNPVWDEVFIVPIEDPFQPIIVK 302
            |||.::.|.:|...|.:. |||||..|:|.:.| |::.:.:::||.|.|.....:.||..|:.:.
plant    11 LRVRVQRGVNLAVRDVSS-SDPYVVLKLGRQKL-KTKVVKQNVNPQWQEDLSFTVTDPNLPLTLI 73

  Fly   303 VFDYDWGLQDDFMGSAKLDLTQLELGKAEDIHLQLCDSSGNGGSGLGEILINLTLWPRSQEDKEM 367
            |:|:|:..:||.||.|::||...    .|.:.::|        |||.:..|..|:.|        
plant    74 VYDHDFFSKDDKMGDAEIDLKPY----IEALRMEL--------SGLPDGTIISTIGP-------- 118

  Fly   368 HFQRNSKLAESS 379
              .|.:.|||.|
plant   119 --SRGNCLAEES 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MctpNP_001261078.1 C2A_MCTP_PRT 237..357 CDD:176007 38/118 (32%)
C2B_MCTP_PRT 390..497 CDD:176022
C2C_MCTP_PRT 537..658 CDD:176023
PRT_C <789..893 CDD:285560
AT1G73580NP_177499.1 C2_ArfGAP 8..151 CDD:176003 45/142 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.