DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mctp and ESYT2

DIOPT Version :9

Sequence 1:NP_001261078.1 Gene:Mctp / 37165 FlyBaseID:FBgn0034389 Length:982 Species:Drosophila melanogaster
Sequence 2:XP_024302614.1 Gene:ESYT2 / 57488 HGNCID:22211 Length:868 Species:Homo sapiens


Alignment Length:574 Identity:127/574 - (22%)
Similarity:210/574 - (36%) Gaps:202/574 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 EAQLRQFVF----FQLRVHLKSGSDLVAMDK------NGLSDPYVKFKVGGRLLHKSRTIHRDLN 281
            |.|:.|..|    ..||:|.....||...|.      .|.||||...:||.::. :||.|..:|:
Human   344 EVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIF-QSRVIKENLS 407

  Fly   282 PVWDEVF-IVPIEDPFQPIIVKVFDYDWGLQDDFMGSAKLDLTQLELGKAED------------I 333
            |.|:||: .:..|.|.|.:.:::||.|.. :|||:||..:||.::|..:..|            :
Human   408 PKWNEVYEALVYEHPGQELEIELFDEDPD-KDDFLGSLMIDLIEVEKERLLDEWFTLDEVPKGKL 471

  Fly   334 HLQL--CDSSGNGGSGLGEILINLTLWPRSQEDKEMHFQRNSKLAESSKRLKSQIWSSVVTILLV 396
            ||:|  .....| .|.|.::|.::      :.||:   |.|..|:           |:::.:.|.
Human   472 HLRLEWLTLMPN-ASNLDKVLTDI------KADKD---QANDGLS-----------SALLILYLD 515

  Fly   397 KAKDLPLA-EDGSKLNDTHFKFRLGNEKYKSKSSWTERWLEQFDLHLFDEDQNLEIALWNRNTLY 460
            .|::||:. :....:.:.:|.|.:.|.|.:             ||.:...|:..:.:|.|.....
Human   516 SARNLPIRYKTNEPVWEENFTFFIHNPKRQ-------------DLEVEVRDEQHQCSLGNLKVPL 567

  Fly   461 GKAII--DLSVFQR------------------------------ENTHG--IWKPLEDCPG-EVH 490
            .:.:.  |::|.||                              ::.|.  :.:|.....| :..
Human   568 SQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTS 632

  Fly   491 LMLTISGT-------TALETI----SDLKAFKE--DPREA------------------------- 517
            :...:||:       ||..|.    ||....:|  .|.||                         
Human   633 IKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVK 697

  Fly   518 ----------------QLLRERYKFLRCLQNLRDVGH------------------LTVKVFGATG 548
                            |.||:|   ||.|:|...:|.                  |.|.|.....
Human   698 EPTPSIASDISLPIATQELRQR---LRQLENGTTLGQSPLGQIQLTIRHSSQRNKLIVVVHACRN 759

  Fly   549 LAAADIGGKSDPFCVLEL-----GNARLQTQTEYKTLTPNWNKIFTFNVKDITQV----LEITV- 603
            |.|....| |||:..:.|     .:.|.:|....|||.|.:::.|.|:| .:.:|    |::.| 
Human   760 LIAFSEDG-SDPYVRMYLLPDKRRSGRRKTHVSKKTLNPVFDQSFDFSV-SLPEVQRRTLDVAVK 822

  Fly   604 -----FDEDRDHRVEFLGKLVIPLL--RIKSGVKRWYTLKDKNLCVRAKGNSPQ 650
                 ..:|:.    .|||:::.|.  .:..|..:||.|.:       .|..||
Human   823 NSGGFLSKDKG----LLGKVLVALASEELAKGWTQWYDLTE-------DGTRPQ 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MctpNP_001261078.1 C2A_MCTP_PRT 237..357 CDD:176007 43/140 (31%)
C2B_MCTP_PRT 390..497 CDD:176022 20/142 (14%)
C2C_MCTP_PRT 537..658 CDD:176023 35/149 (23%)
PRT_C <789..893 CDD:285560
ESYT2XP_024302614.1 SMP_LBD 163..342 CDD:293652
C2A_C2C_Synaptotagmin_like 357..477 CDD:176037 39/121 (32%)
C2B_Synaptotagmin-like 509..589 CDD:176015 17/92 (18%)
C2C_KIAA1228 733..858 CDD:175996 30/130 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2311
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.