DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mctp and fic1

DIOPT Version :9

Sequence 1:NP_001261078.1 Gene:Mctp / 37165 FlyBaseID:FBgn0034389 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_595651.1 Gene:fic1 / 2541203 PomBaseID:SPBC83.18c Length:272 Species:Schizosaccharomyces pombe


Alignment Length:110 Identity:32/110 - (29%)
Similarity:55/110 - (50%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 VGHLTVKVFGATGLAAADIGGKSDPFCVLELGNARLQTQTEYKT-LTPNWNKIFTFNV-KDITQV 598
            :|.|.|:::.|..|....:.||..|:||..:|....:|||:.:: ..|:||.:..||: .:...:
pombe     6 LGTLVVRIWKAKNLPNKALVGKQSPYCVCRVGEVVKRTQTDKRSGQEPSWNAVLEFNIPSESYHI 70

  Fly   599 LEITVFDEDRDHRVEFLGKLVIPLLRIKSGVK-----RWYTLKDK 638
            ::||||.|........:|..|   |..:..:|     .||.||::
pombe    71 MKITVFHEGFRKHPHLIGDTV---LSFEKAMKEELQSEWYELKNE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MctpNP_001261078.1 C2A_MCTP_PRT 237..357 CDD:176007
C2B_MCTP_PRT 390..497 CDD:176022
C2C_MCTP_PRT 537..658 CDD:176023 32/109 (29%)
PRT_C <789..893 CDD:285560
fic1NP_595651.1 C2_fungal_Inn1p-like 7..125 CDD:176063 32/109 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2311
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.