DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mctp and ESYT1

DIOPT Version :9

Sequence 1:NP_001261078.1 Gene:Mctp / 37165 FlyBaseID:FBgn0034389 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_001171725.1 Gene:ESYT1 / 23344 HGNCID:29534 Length:1114 Species:Homo sapiens


Alignment Length:564 Identity:134/564 - (23%)
Similarity:220/564 - (39%) Gaps:188/564 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 EHPENGSAGCSPP---------ELSTQQQLEALQANELRRKREAQLRQFVFFQLRVHLKSGSDLV 249
            |:|:.||:..:||         :..|:.                        .||:|:....||:
Human   630 ENPQRGSSVDAPPRPCHTTPDSQFGTEH------------------------VLRIHVLEAQDLI 670

  Fly   250 AMDK------NGLSDPYVKFKVGGRLLHKSRTIHRDLNPVWDEVF-IVPIEDPFQPIIVKVFDYD 307
            |.|:      .|.||||||.|:.||.. :|..:..||||.|:||| ::....|.|.:.|:|||.|
Human   671 AKDRFLGGLVKGKSDPYVKLKLAGRSF-RSHVVREDLNPRWNEVFEVIVTSVPGQELEVEVFDKD 734

  Fly   308 WGLQDDFMGSAKLDLTQL-------ELGKAEDI-----HLQLCDSSGNGGSGLGEILINLTLWPR 360
            .. :|||:|..|:.||.:       |....||:     ||:               |..||..|.
Human   735 LD-KDDFLGRCKVRLTTVLNSGFLDEWLTLEDVPSGRLHLR---------------LERLTPRPT 783

  Fly   361 SQEDKEMHFQRNSKLAESSKRLKSQIWSSVVTILLVKAKDLPLAEDGSKLNDTHFKFRLGNEKYK 425
            :.|.:|: .|.|| |.::.|  .:::.:::::|.:.:|:||||.: |:|....:....:|:..:|
Human   784 AAELEEV-LQVNS-LIQTQK--SAELAAALLSIYMERAEDLPLRK-GTKHLSPYATLTVGDSSHK 843

  Fly   426 SKSSWTERWLEQFDLHLFDED----------QNLEIALWNRNT-LYGKAIIDLS--------VFQ 471
            :|:      :.|....::||.          ::||:.:....| :.|...:.||        ...
Human   844 TKT------ISQTSAPVWDESASFLIRKPHTESLELQVRGEGTGVLGSLSLPLSELLVADQLCLD 902

  Fly   472 RENTHGIWKPLEDCPGEV----HLMLTISGTTALETIS-----DLKAFKEDPR----------EA 517
            |      |..|....|:|    .|.:.:|..:.:|..|     ...:..|:|.          .|
Human   903 R------WFTLSSGQGQVLLRAQLGILVSQHSGVEAHSHSYSHSSSSLSEEPELSGGPPHITSSA 961

  Fly   518 QLLRER------------------------YKFLRCLQNLRDVGHLTVKVFGATGLAAADIGGKS 558
            ..||:|                        |...|.|.::         |.|...|..   .|:.
Human   962 PELRQRLTHVDSPLEAPAGPLGQVKLTLWYYSEERKLVSI---------VHGCRSLRQ---NGRD 1014

  Fly   559 --DPFCVLEL------GNARLQTQTEYKTLTPNWNKIFTFNVK---------DITQVLEITVFDE 606
              ||:..|.|      |..| :|..:.:||:|.:|:.|.:.:.         |::.....:....
Human  1015 PPDPYVSLLLLPDKNRGTKR-RTSQKKRTLSPEFNERFEWELPLDEAQRRKLDVSVKSNSSFMSR 1078

  Fly   607 DRDHRVEFLGKLVIPLLR--IKSGVKRWYTLKDKNLCVRAKGNS 648
            :|    |.|||:.:.|..  :..||.|||.|.|.    :.||:|
Human  1079 ER----ELLGKVQLDLAETDLSQGVARWYDLMDN----KDKGSS 1114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MctpNP_001261078.1 C2A_MCTP_PRT 237..357 CDD:176007 47/138 (34%)
C2B_MCTP_PRT 390..497 CDD:176022 26/129 (20%)
C2C_MCTP_PRT 537..658 CDD:176023 33/131 (25%)
PRT_C <789..893 CDD:285560
ESYT1NP_001171725.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SMP_LBD 135..313 CDD:293652
C2A_C2C_Synaptotagmin_like 329..448 CDD:176037
C2B_Synaptotagmin-like 479..593 CDD:176015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 627..651 6/20 (30%)
C2A_C2C_Synaptotagmin_like 657..776 CDD:176037 45/159 (28%)
C2B_Synaptotagmin-like 809..910 CDD:176015 23/113 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 934..960 3/25 (12%)
C2C_KIAA1228 981..1106 CDD:175996 31/141 (22%)
Required for phosphatidylinositol 4,5-bisphosphate-dependent location at the cell membrane. /evidence=ECO:0000250 1028..1035 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2311
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.