DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and AT1G73340

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001319373.1 Gene:AT1G73340 / 843669 AraportID:AT1G73340 Length:487 Species:Arabidopsis thaliana


Alignment Length:465 Identity:110/465 - (23%)
Similarity:178/465 - (38%) Gaps:95/465 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PGMMGKP---------NAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLA 152
            ||..|.|         |||...:|..|..              :.:..|.:|....:|       
plant    45 PGSRGWPLIGDTFAWLNAVAGSHPSSFVE--------------KQIKKYGRIFSCSLF------- 88

  Fly   153 SDQGQEWADIRNKVNPVLMKVQNVRQNLPQL----------DQISKEFIDKLETQRNPETHTLTT 207
                .:||.:  ..:|...:.  :.||..:|          |.:.|:.:..:...:....|::.:
plant    89 ----GKWAVV--SADPDFNRF--IMQNEGKLFQSSYPKSFRDLVGKDGVITVHGDQQRRLHSIAS 145

  Fly   208 DF--HNQLKMWAFESISFVALNT-------RMGLLSD-----------------NPDPNADRLAK 246
            ..  |:|||....|.|..|.|.|       .:.||.|                 :.:...|.:::
plant   146 SMMRHDQLKTHFLEVIPVVMLQTLSNFKDGEVVLLQDICRKVAIHLMVNQLLGVSSESEVDEMSQ 210

  Fly   247 HMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLE 311
            ...||.:......:....:|      :.|.:|....|....:..||..::....:|..... ||.
plant   211 LFSDFVDGCLSVPIDLPGFT------YNKAMKARKEIIRKINKTIEKRLQNKAASDTAGNG-VLG 268

  Fly   312 QLLEH----NKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSL 372
            :|||.    |:.:| ..::::|.||.:|||...|..:|.|...|....:|..|..|:   ....|
plant   269 RLLEEESLPNESMA-DFIINLLFAGNETTSKTMLFAVYFLTHCPKAMTQLLEEHDRL---AGGML 329

  Fly   373 TDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQ 437
            |.|:.|.|.:.:..|.|.||:..|.....|...:|:....|.:|:|..|:..:..:..|:.|:.:
plant   330 TWQDYKTMDFTQCVIDETLRLGGIAIWLMREAKEDVSYQDYVIPKGCFVVPFLSAVHLDESYYKE 394

  Fly   438 SSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKV 502
            |..|.|.|||.    |:.|.....|| :|| |.|||.|.|.|.|..:|.|:|...|...:.:||.
plant   395 SLSFNPWRWLD----PETQQKRNWRT-SPF-YCPFGGGTRFCPGAELARLQIALFLHYFITTYKW 453

  Fly   503 SWLPETPIEY 512
            :.|.|..|.:
plant   454 TQLKEDRISF 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 109/462 (24%)
AT1G73340NP_001319373.1 CYP90-like 75..479 CDD:410669 101/421 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.