DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and CYP707A3

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_851136.1 Gene:CYP707A3 / 834570 AraportID:AT5G45340 Length:463 Species:Arabidopsis thaliana


Alignment Length:466 Identity:102/466 - (21%)
Similarity:181/466 - (38%) Gaps:108/466 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PGMMG-------------KPNAVFTYNPDDFEMTYRNE--GVWPIRIGLESLNYYRKIHRPDVFK 146
            ||.||             .||..|......:...::..  |...:.|.......:..:.:..:||
plant    38 PGTMGYPYVGETFQLYSQDPNVFFAAKQRRYGSVFKTHVLGCPCVMISSPEAAKFVLVTKSHLFK 102

  Fly   147 -----------GVGGLASDQGQEWADIRNKVNPVLMKV---QNVRQNLPQLDQISKEFIDKLE-T 196
                       |...:...||    |..:|:..::::.   ..:|..:|.::.|::|.::..: |
plant   103 PTFPASKERMLGKQAIFFHQG----DYHSKLRKLVLRAFMPDAIRNMVPHIESIAQESLNSWDGT 163

  Fly   197 QRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQ 261
            |.|.         :.::|.:.|.    |||.:.:|                 :|...|  :.|::
plant   164 QLNT---------YQEMKTYTFN----VALISILG-----------------KDEVYY--REDLK 196

  Fly   262 PSIWTFYKTAG----------FKKFLKTYDNITDITSNYIETAMRG-------FGKNDDGKTKCV 309
            ...:...|...          |.|.:|....:..|.:|.:....:.       .|...:.|....
plant   197 RCYYILEKGYNSMPINLPGTLFHKAMKARKELAQILANILSKRRQNPSSHTDLLGSFMEDKAGLT 261

  Fly   310 LEQLLEHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTK--DSL 372
            .||:.::        ::.::.|..|||:|....||.:||.||:..|.:..|.:.|....|  :||
plant   262 DEQIADN--------IIGVIFAARDTTASVLTWILKYLADNPTVLEAVTEEQMAIRKDKKEGESL 318

  Fly   373 TDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQ 437
            |.::||.||.....|:|.||..:|....||...:|:...||.:|:|..||.....:.::...|:.
plant   319 TWEDTKKMPLTYRVIQETLRAATILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHNADIFSD 383

  Fly   438 SSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKV 502
            ..:|.|.|:   ::||           .|..::|||.|..:|.|..:|:|||..|:..|...|:.
plant   384 PGKFDPSRF---EVAP-----------KPNTFMPFGSGIHSCPGNELAKLEISVLIHHLTTKYRW 434

  Fly   503 SWL-PETPIEY 512
            |.: |...|:|
plant   435 SIVGPSDGIQY 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 100/463 (22%)
CYP707A3NP_851136.1 PLN02196 1..463 CDD:177847 102/466 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.