DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and CYP716A2

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_198463.1 Gene:CYP716A2 / 833611 AraportID:AT5G36140 Length:318 Species:Arabidopsis thaliana


Alignment Length:275 Identity:56/275 - (20%)
Similarity:110/275 - (40%) Gaps:71/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 MMGKPNAVFT-YNPDDFEMTYRNEGV---WPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEW 159
            :.|.|.||.| .:.:.|..|..|:.|   ||     :|:|        .:|.  ....:...:|.
plant    78 LFGSPFAVVTGASGNKFLFTNENKLVISWWP-----DSVN--------KIFP--SSTQTSSKEEA 127

  Fly   160 ADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKMWAF---ESI 221
            ...|..:.| .||.:.:|:.:..:|:|:::..:              |::.||.::..|   :..
plant   128 IKTRMLLMP-SMKPEALRRYVGVMDEIAQKHFE--------------TEWANQDQLIVFPLTKKF 177

  Fly   222 SFVALNTRMGLLSDNPDPNADRLAKHMRDFFN-----YSFQFDVQPSIWTFYKTAGFKKFLKTYD 281
            :| ::..|:.|..|    :.:|:.|....|..     :|...|:..:        .|.:.:|.  
plant   178 TF-SIACRLFLSMD----DLERVRKLEEPFTTVMTGVFSIPIDLPGT--------RFNRAIKA-- 227

  Fly   282 NITDITSNYIETAMRGFGKNDDGKT-KCVLEQ-LLEH--------NKKVAVTMVMDMLMAGIDTT 336
              :.:.|..:.|.:|  .:.::.|. |..:|| :|.|        ..:.....::.:|:.|.|||
plant   228 --SRLLSKEVSTIIR--QRKEELKAGKVSVEQDILSHMLMNIGETKDEDLADKIIALLIGGHDTT 288

  Fly   337 SSACLTILYHLARNP 351
            |..|..::.:||..|
plant   289 SIVCTFVVNYLAEFP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 56/275 (20%)
CYP716A2NP_198463.1 cytochrome_P450 65..>311 CDD:425388 56/275 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.