DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and CYP82C2

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_194925.1 Gene:CYP82C2 / 829327 AraportID:AT4G31970 Length:523 Species:Arabidopsis thaliana


Alignment Length:394 Identity:95/394 - (24%)
Similarity:165/394 - (41%) Gaps:60/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 QNLPQLDQISKEFIDKLETQRNPETHTLTTDFHN-------------QLKMWAFESISFVALNTR 229
            :.:..|:.:|...:..|:..|..|...:..|.::             .||.| .|.:| :.:..|
plant   131 RKIATLELLSNRRLQMLKHVRVSEISMVMQDLYSLWVKKGGSEPVMVDLKSW-LEDMS-LNMMVR 193

  Fly   230 M---------GLLSDNPDPNADRLAKHMRDFFNYSFQF---DVQPSIWTFYKTAGFKKFLKTYDN 282
            |         |.||......|.:..|.:.:||:....|   |..|.:..|......|:..:|...
plant   194 MVAGKRYFGGGSLSPEDAEEARQCRKGVANFFHLVGIFTVSDAFPKLGWFDFQGHEKEMKQTGRE 258

  Fly   283 ITDITSNYIET-----AMRGFGKNDDGKTKCVL---EQ----LLEHNKKVAVTMVMDMLMAGIDT 335
            :..|...:||.     .:.|...||......:|   ||    .|:|:...::......|:.|...
plant   259 LDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKFSHLQHDAITSIKSTCLALILGGSE 323

  Fly   336 TSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITP-- 398
            ||.:.||....|..|.....|..::.:.|......::.|.:.:|:.|::|.|||.||:....|  
plant   324 TSPSTLTWAISLLLNNKDMLKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGPLL 388

  Fly   399 GNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAART 463
            |: |...:|..::||.|.|||.:|:.|.::..|.:.:.:.:||.|||::..: |.:..    .|.
plant   389 GH-REAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGE-AKEFD----VRG 447

  Fly   464 RNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYEST------------I 516
            :| |..:|||.|.|:|.|..:|...:...|.|.|:|:.|..:.:.|::...:            |
plant   448 QN-FELMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKATPLEI 511

  Fly   517 ILSP 520
            ::||
plant   512 LISP 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 92/371 (25%)
CYP82C2NP_194925.1 CYP82 67..516 CDD:410747 95/394 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.