DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and CYP707A4

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_566628.1 Gene:CYP707A4 / 821461 AraportID:AT3G19270 Length:468 Species:Arabidopsis thaliana


Alignment Length:502 Identity:114/502 - (22%)
Similarity:204/502 - (40%) Gaps:126/502 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IDEKWQQARSFGEIPGPSL--------LRMLSFFMPGGALRNTNLIQMNRLMREMYGDIY----- 94
            :.:|.:.:|  |::|..|:        |::.|        :|.|:...::..|  ||:|:     
plant    23 VSKKKKNSR--GKLPPGSMGWPYLGETLQLYS--------QNPNVFFTSKQKR--YGEIFKTRIL 75

  Fly    95 ---CIPGMMGKPNA---VFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLAS 153
               |:  |:..|.|   |...:...|:.||...                    .:...|...|..
plant    76 GYPCV--MLASPEAARFVLVTHAHMFKPTYPRS--------------------KEKLIGPSALFF 118

  Fly   154 DQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRN-PETHTLTTDFHNQLKMWA 217
            .||...:.||..|...... :.:|:.:|.::.|:   :..|::..| |...|     :.::|.:|
plant   119 HQGDYHSHIRKLVQSSFYP-ETIRKLIPDIEHIA---LSSLQSWANMPIVST-----YQEMKKFA 174

  Fly   218 FESISFVALNTRMGLLS--DNPDPNADRLAKHMRDFFNYSF------QFDVQPSIWTFYKTAGFK 274
            |:          :|:|:  .:.:.:...:.||     ||:.      .|.:.....:::|....:
plant   175 FD----------VGILAIFGHLESSYKEILKH-----NYNIVDKGYNSFPMSLPGTSYHKALMAR 224

  Fly   275 KFLKTYDNITDI-----TSNYIETAMRGF---GKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMA 331
            |.|||.  :::|     ....::|...|.   .||:.|:. ...||:.::        ::.:|.|
plant   225 KQLKTI--VSEIICERREKRALQTDFLGHLLNFKNEKGRV-LTQEQIADN--------IIGVLFA 278

  Fly   332 GIDTTSSACLT-ILYHLARNPSKQEKLRRELLRILPTT---KDSLTDQNTKNMPYLRACIKEGLR 392
            ..|||:| ||| ||.:|..:....|.::.|...|....   |..||.:.|:|||.....|.|.||
plant   279 AQDTTAS-CLTWILKYLHDDQKLLEAVKAEQKAIYEENSREKKPLTWRQTRNMPLTHKVIVESLR 342

  Fly   393 ITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQA 457
            :.||....||....|:...||.:|:|..|:.....:.::.|||:....|.|.|:   ::.|    
plant   343 MASIISFTFREAVVDVEYKGYLIPKGWKVMPLFRNIHHNPKYFSNPEVFDPSRF---EVNP---- 400

  Fly   458 CPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSW 504
                   .|..::|||.|...|.|..:|:|:|...|..|:.:::  |
plant   401 -------KPNTFMPFGSGVHACPGNELAKLQILIFLHHLVSNFR--W 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 110/486 (23%)
CYP707A4NP_566628.1 p450 6..467 CDD:299894 114/502 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.