DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and CYP712A1

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_181754.1 Gene:CYP712A1 / 818826 AraportID:AT2G42250 Length:514 Species:Arabidopsis thaliana


Alignment Length:463 Identity:106/463 - (22%)
Similarity:187/463 - (40%) Gaps:73/463 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFE-MTYRNEGVWPIRIG- 129
            |....|:|..|.|.|....: ...|.::.|..::          |..|: :.::...:..||:| 
plant    29 FLKEQGSLAATKLPQSPPAL-PFIGHLHLIGKVL----------PVSFQSLAHKYGPLMEIRLGA 82

  Fly   130 -----LESLNYYRKI---------HRPDV-------FKGVGGLASDQGQEWADIRNKVNPVLMKV 173
                 :.|.:..|:|         .||:.       ::|...:.:..|..|..::......|:.|
plant    83 SKCVVVSSSSVAREIFKEQELNFSSRPEFGSAEYFKYRGSRFVLAQYGDYWRFMKKLCMTKLLAV 147

  Fly   174 QNVRQNLPQLDQIS----KEFIDKLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLS 234
                   |||::.:    :|.:..:::........|..|..:|...:....|..:|::||..   
plant   148 -------PQLEKFADIREEEKLKLVDSVAKCCREGLPCDLSSQFIKYTNNVICRMAMSTRCS--- 202

  Fly   235 DNPDPNADRLAKHMRDFFNYSFQF-------DVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIE 292
                 ..|..|:.:|:....|.:.       ||...:.....:...||.:...:.. |:....|.
plant   203 -----GTDNEAEEIRELVKKSLELAGKISVGDVLGPLKVMDFSGNGKKLVAVMEKY-DLLVERIM 261

  Fly   293 TAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTM----------VMDMLMAGIDTTSSACLTILYHL 347
            .......|..||..|.:|:.|||..:.....|          ::|:.|||.||:::|....:..|
plant   262 KEREAKAKKKDGTRKDILDILLETYRDPTAEMKITRNDMKSFLLDVFMAGTDTSAAAMQWAMGQL 326

  Fly   348 ARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSG 412
            ..:|....|||.|:..:: .:|..:.:.:..|:|||||.::|.||:....|...|...:|..::|
plant   327 INHPQAFNKLREEINNVV-GSKRLVKESDVPNLPYLRAVLRETLRLHPSAPLIIRECAEDCQVNG 390

  Fly   413 YQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPR 477
            ..|...|.||:.|..:..|.:.:|.:..|||||:|:|......:.....:.:| |.|||||.|.|
plant   391 CLVKSKTRVLVNVYAIMRDSELWADADRFIPERFLESSEEKIGEHQMQFKGQN-FRYLPFGSGRR 454

  Fly   478 TCIGKRIA 485
            .|.|..:|
plant   455 GCPGASLA 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 106/463 (23%)
CYP712A1NP_181754.1 p450 9..508 CDD:299894 106/463 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.