DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and cyp26b1

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001072655.1 Gene:cyp26b1 / 780112 XenbaseID:XB-GENE-991500 Length:511 Species:Xenopus tropicalis


Alignment Length:492 Identity:114/492 - (23%)
Similarity:201/492 - (40%) Gaps:87/492 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSQQT-QLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDI 93
            :|||. ||..|.:| |:..:.....|.:..|.:.....:.:.|...:::.        ||.||::
 Frog    28 VSQQLWQLRWAATR-DKSCKLPIPKGSMGFPLVGETFHWILQGSDFQSSR--------REKYGNV 83

  Fly    94 YCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIG---LESLNYYRKIHRPDVFKGVGGLASDQ 155
            : ...::|:|....|          ..|.|..|.:|   |.|..:.|...   :..|...||:..
 Frog    84 F-KTHLLGRPLIRVT----------GAENVRKILMGEHHLVSTEWPRSTR---MLLGPNSLANSI 134

  Fly   156 GQEWADIRNKVNPVLMKV---QNVRQNLPQLDQISKEFIDKLET-QRNPETHTLTTDFHNQLKMW 216
            |    ||......|..|:   :.:...||::..:.:   |.|.. ..|||    :.:.:.:.:..
 Frog   135 G----DIHRHKRKVFSKIFSHEALESYLPKIQLVIQ---DTLRVWSSNPE----SINVYCEAQKL 188

  Fly   217 AFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYD 281
            .|.....|.|..|:.      |....:|.:..:.|....|...|....      :|:::.::.  
 Frog   189 TFRMAIRVLLGFRLS------DEELSQLFQVFQQFVENVFSLPVDVPF------SGYRRGIRA-- 239

  Fly   282 NITDITSNYIETAMRGFGKNDDGK-----TKCVLEQLLEHNKKVAVTMVMD----MLMAGIDTTS 337
              .::....:|.|::...:|..||     ...::|...||.|::.:..:.|    ::.|...||:
 Frog   240 --REMLLKSLEKAIQEKLQNTQGKDYADALDILIESGKEHGKELTMQELKDGTLELIFAAYATTA 302

  Fly   338 SACLTILYHLARNPSKQEKLRREL-----LRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSIT 397
            ||..:::..|.::||..||||.||     |......:.:|..:...::.||...|||.||:.|..
 Frog   303 SASTSLIMQLLKHPSVLEKLREELRGNSILHNGCVCEGALRVETISSLHYLDCVIKEILRLFSPV 367

  Fly   398 PGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAAR 462
            .|.:|...:...|.|:|:|:|..||..:.:..:....|.....|.|:|:.:.            |
 Frog   368 SGGYRTVLQTFELDGFQIPKGWSVLYSIRDTHDTAPVFKDVDVFDPDRFGQD------------R 420

  Fly   463 TRNP---FVYLPFGFGPRTCIGKRIAELEIETLLVRL 496
            |.:.   |.|||||.|.|.|:||.:|:|.::.|.:.|
 Frog   421 TEDKDGRFHYLPFGGGVRNCLGKHLAKLFLKVLAIEL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 105/462 (23%)
cyp26b1NP_001072655.1 p450 1..468 CDD:386267 114/492 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.