DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and CYP26B1

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_063938.1 Gene:CYP26B1 / 56603 HGNCID:20581 Length:512 Species:Homo sapiens


Alignment Length:517 Identity:112/517 - (21%)
Similarity:204/517 - (39%) Gaps:136/517 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSQQT-QLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDI 93
            :|||. ||..|.:| |:..:.....|.:..|.:.....:.:.|...:::.        ||.||::
Human    28 VSQQLWQLRWAATR-DKSCKLPIPKGSMGFPLIGETGHWLLQGSGFQSSR--------REKYGNV 83

  Fly    94 YCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRI-GLESLNYYRKIHRPDVFKGVGGLASDQGQ 157
            : ...::|:|                     .||: |.|::   |||     ..|...|.|   .
Human    84 F-KTHLLGRP---------------------LIRVTGAENV---RKI-----LMGEHHLVS---T 115

  Fly   158 EW-----------------ADIRNKVNPVLMKV---QNVRQNLPQLDQISKEFIDKLETQRNPET 202
            ||                 .||......|..|:   :.:...||::..:.:      :|.|...:
Human   116 EWPRSTRMLLGPNTVSNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQ------DTLRAWSS 174

  Fly   203 HTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTF 267
            |....:.:.:.:...|.    :|:...:|.  ..|:.:...|.:..:.|.:..|...|.      
Human   175 HPEAINVYQEAQKLTFR----MAIRVLLGF--SIPEEDLGHLFEVYQQFVDNVFSLPVD------ 227

  Fly   268 YKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGK-----TKCVLEQLLEHNKKVAVTMVMD 327
            ...:|:::.::.    ..|....:|.|:|...:...||     ...::|...||.|::.:..:.|
Human   228 LPFSGYRRGIQA----RQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKD 288

  Fly   328 ----MLMAGIDTTSSACLTILYHLARNPSKQEKLRREL----------------LRILPTTKDSL 372
                ::.|...||:||..:::..|.::|:..||||.||                ||:     |:|
Human   289 GTLELIFAAYATTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRL-----DTL 348

  Fly   373 TDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQ 437
            :     .:.||...|||.:|:.:...|.:|...:...|.|:|:|:|..|:..:.:..:....|..
Human   349 S-----GLRYLDCVIKEVMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKD 408

  Fly   438 SSEFIPERWLKSDLAPDIQACPAARTRNP---FVYLPFGFGPRTCIGKRIAELEIETLLVRL 496
            .:.|.|:|:.:            ||:.:.   |.|||||.|.|||:||.:|:|.::.|.|.|
Human   409 VNVFDPDRFSQ------------ARSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVEL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 103/487 (21%)
CYP26B1NP_063938.1 p450 23..490 CDD:325183 112/517 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.