DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and Cyp6a22

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster


Alignment Length:400 Identity:99/400 - (24%)
Similarity:166/400 - (41%) Gaps:32/400 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GGLASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKL-ETQRNPETHTLTTDFHNQ 212
            |.|....|.:|..:|.|::|.....: ::...|.:.::.:|..... |...|.....|  :..:.
  Fly   116 GHLFRIDGPKWRPLRQKMSPTFTSAK-MKYMFPTVCEVGEELTQVCGELADNAMCGIL--EIGDL 177

  Fly   213 LKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFL 277
            :..:..:.|...|.......|.   :|.|:......|.|........|...|.:|.:.|.|.:..
  Fly   178 MARYTSDVIGRCAFGVECNGLR---NPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMR 239

  Fly   278 KTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDM-------LMAGIDT 335
            :.:.:|||.....:...::  .:.:.|..:.....||...|:.....:.:|       ..||.||
  Fly   240 QIHQDITDFYVGIVRETVK--QREEQGIVRSDFMNLLIEMKQRGELTIEEMAAQAFIFFAAGFDT 302

  Fly   336 TSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGN 400
            ::|.....||.||:.|:.|.|||.|:.:.|.......|..:.:.:.|:...|.|.||...|.|..
  Fly   303 SASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRKYPILPQL 367

  Fly   401 FRITPKDLVLSG---YQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAAR 462
            .||:.......|   :.:..|..:|:.|..:.:|...:.:..:|||||:|...||          
  Fly   368 TRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQLA---------- 422

  Fly   463 TRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPET--PIEY-ESTIILSPCGDI 524
            .|....:||||.|||.|||.|..:::....||.|||::..|..|.|  .||: :|.|:|.|...|
  Fly   423 QRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNILLCPANGI 487

  Fly   525 RFKLEPVGDL 534
            ..|::.:..:
  Fly   488 YLKVQQLSQM 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 91/374 (24%)
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 98/392 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.