DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and Cyp6a18

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster


Alignment Length:415 Identity:106/415 - (25%)
Similarity:173/415 - (41%) Gaps:72/415 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GQEWADIRNKVNPVL----MKVQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKMW 216
            |.:|..:|:|::...    ||..     .|.:..:::||:..:. ::..|...|  |..:.:..:
  Fly   126 GPQWRLLRSKLSSTFTSGKMKFM-----YPTVVSVAEEFMAVMH-EKVSENSIL--DVRDLVARF 182

  Fly   217 AFESISFVALNTRMGLLSDNPDPNADRL---------AKH-------MRDFFNYSFQFDV---QP 262
            ..:.|...|...:...|.|.   .|:.|         ::|       ||.:.|.:.:..:   ..
  Fly   183 TVDVIGTCAFGIKCNSLRDE---KAEFLHFGRRALLDSRHGNLVSGLMRSYPNLARRLGLCRNTA 244

  Fly   263 SIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMD 327
            .|..||:.  ..|...|.....:|..|.....:.|. ||....|       || |.:|...:.||
  Fly   245 QIQEFYQR--IVKETVTLREKENIKRNDFMDMLIGL-KNQKNMT-------LE-NGEVVKGLTMD 298

  Fly   328 --------MLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLR 384
                    ..:||.||:||.....||.||:|||.|:|:|.||.::|.......|.:..|::.||.
  Fly   299 EIVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTYECIKDLKYLD 363

  Fly   385 ACIKEGLRITSITPGNFRITPKDLVLSG---YQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERW 446
            ..|.|.||..:|.|...|:..|..|:.|   :.:..|..|::....:.:|...:.:.:||.|||:
  Fly   364 QVINETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEPNEFRPERF 428

  Fly   447 LKSDLAPDIQACPAARTRNPFV-YLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETP- 509
                       .|....:.|.| :||||.|||.|||.|..:::....|..|::::..|....|| 
  Fly   429 -----------SPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSATPD 482

  Fly   510 ---IEYESTIILSPCGDIRFKLEPV 531
               .:..|.|:|...|.|:.|:|.:
  Fly   483 PLTFDPHSAILLGIKGGIQLKVEAI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 99/393 (25%)
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 104/410 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.