DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and shd

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster


Alignment Length:509 Identity:135/509 - (26%)
Similarity:232/509 - (45%) Gaps:55/509 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QQARSFGEIPGPSLLRMLS----FFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFT 108
            ::.|...:||||..:..|.    |.:.....:.|.|.::...:...|||| .:..|......|..
  Fly    54 RRRRGIWDIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDI-VLEVMPSNVPIVHL 117

  Fly   109 YNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKV 173
            ||.||.|...:....:|.|...|.:..||: .|||.:..| |:.::||..|..:|:.:...:...
  Fly   118 YNRDDLEKVLKYPSKYPFRPPTEIIVMYRQ-SRPDRYASV-GIVNEQGPMWQRLRSSLTSSITSP 180

  Fly   174 QNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLS-DNP 237
            :.::..||.|:.:..:||:.|..:|:|:| .:..:|.....:...|::..:.|..|||.|: |..
  Fly   181 RVLQNFLPALNAVCDDFIELLRARRDPDT-LVVPNFEELANLMGLEAVCTLMLGRRMGFLAIDTK 244

  Fly   238 DP-NADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKN 301
            .| ...:||..::..|...........:|.::.|..::.|.:..|.|.|:.|..|:..:....|:
  Fly   245 QPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIIDHELEELKKS 309

  Fly   302 ----DD--GKTKCVLEQLLE------HNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQ 354
                ||  ...:.:...:||      .:||.|   ::|.:.|||:|.::..|.:|..:..:|...
  Fly   310 AACEDDEAAGLRSIFLNILELKDLDIRDKKSA---IIDFIAAGIETLANTLLFVLSSVTGDPGAM 371

  Fly   355 EKLRRELLRILPTT--KDSLTDQNTKNMPYLRACIKEGLRITSITPGNF---RITPKDLVLSGYQ 414
            .::..|......|.  :|:||     |..|.:|||:|..|   :.|..|   ||..:|:.||||.
  Fly   372 PRILSEFCEYRDTNILQDALT-----NATYTKACIQESYR---LRPTAFCLARILEEDMELSGYS 428

  Fly   415 VPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPA-----ARTRNPFVYLPFGF 474
            :..||.||...:...:.|..|..:.:|.||||:.          ||     ....|..:.:|||.
  Fly   429 LNAGTVVLCQNMIACHKDSNFQGAKQFTPERWID----------PATENFTVNVDNASIVVPFGV 483

  Fly   475 GPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYESTIILSPCGDIRFKL 528
            |.|:|.|||..|:|:..||.:::.::.||::  .|:|.|...:|:|...:..:|
  Fly   484 GRRSCPGKRFVEMEVVLLLAKMVLAFDVSFV--KPLETEFEFLLAPKTPLSLRL 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 126/479 (26%)
shdNP_001261843.1 p450 63..528 CDD:299894 131/491 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.