DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and Cyp6a13

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_610390.1 Gene:Cyp6a13 / 35837 FlyBaseID:FBgn0033304 Length:493 Species:Drosophila melanogaster


Alignment Length:416 Identity:105/416 - (25%)
Similarity:168/416 - (40%) Gaps:77/416 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GGLASDQGQEWADIRNKVNPVL----MKVQNVRQNLPQLDQISKEFIDKLETQRNP-ETHTLTTD 208
            |.|....|.||..:|..:..|.    ||..     .|.:.::.::.......|... |...|...
  Fly   115 GNLLFLDGPEWRWLRQNLTQVFTSGKMKFM-----FPNMVEVGEKLTQACRLQVGEIEAKDLCAR 174

  Fly   209 FHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKH-----MRDFFNYSFQFDVQPSI---- 264
            |...:       |...|.......|.| |:....|:.:.     :......:|.| .||.:    
  Fly   175 FTTDV-------IGSCAFGLECNSLQD-PESQFRRMGRSVTQEPLHSVLVQAFMF-AQPELARKL 230

  Fly   265 -WTFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLL----EHNKKVAVT- 323
             :..::....:.||.|.....|....      ....:||       |.|||    |...|.|:: 
  Fly   231 RFRLFRPEVSEFFLDTVRQTLDYRRR------ENIHRND-------LIQLLMELGEEGVKDALSF 282

  Fly   324 -----MVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYL 383
                 ..:...:||.||:|:.....||.||.||..||:||.|:|.:|......||..:.:.||||
  Fly   283 EQIAAQALVFFLAGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYL 347

  Fly   384 RACIKEGLRITSITPGNFRITPKDLVLSGYQVPR-------GTGVLMGVLELSNDDKYFAQSSEF 441
            ...:.|.||...|.|...|.:.|:     ||:|.       |:.:::.|..:.:|.:.:....:|
  Fly   348 DQVVAETLRKYPILPHLLRRSTKE-----YQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKF 407

  Fly   442 IPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLP 506
            .|.|:...::          :.|:||.|||||.|||.|||:|..:|:::..||.|||.:|.|...
  Fly   408 DPSRFEPEEI----------KARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSE 462

  Fly   507 ET--PIEYES-TIILSPCGDIRFKLE 529
            :|  |:::.| ..::|....:..::|
  Fly   463 KTQIPLKFSSRNFLISTQEGVHLRME 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 102/395 (26%)
Cyp6a13NP_610390.1 p450 33..476 CDD:278495 103/402 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.