DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and Cyp28a5

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_609694.1 Gene:Cyp28a5 / 34817 FlyBaseID:FBgn0028940 Length:505 Species:Drosophila melanogaster


Alignment Length:521 Identity:120/521 - (23%)
Similarity:201/521 - (38%) Gaps:136/521 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IPGMMGK------PNAVFT------YNPDDFEMTYRNE----GVW-----------PIRIGLESL 133
            :||...|      || :||      |:.||....|:|:    |::           |.......:
  Fly    32 VPGPKPKLLCGNYPN-MFTMKRHAIYDLDDIYRQYKNKYDAVGIFGSRSPQLLVINPALARRVFV 95

  Fly   134 NYYRKIHRPDVFKGV---------GGLASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKE 189
            :.::..|..::.|.:         ....|..|::|...|..|.|.| .:..::...|..:::.::
  Fly    96 SNFKNFHDNEIAKNIDEKTDFIFANNPFSLTGEKWKTRRADVTPGL-TMGRIKTVYPVTNKVCQK 159

  Fly   190 FIDKLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNY 254
            ..:.:|.|....:.......|..| .:..|.::...|.......||.|.|    :...:.|.|| 
  Fly   160 LTEWVEKQLRLGSKDGIDAKHMSL-CFTTEMVTDCVLGLGAESFSDKPTP----IMSKINDLFN- 218

  Fly   255 SFQFDVQPSIWT----FYKTAGF----------------KKFLKTYDNITDITSNYIET------ 293
                  ||  ||    |..|:.|                ::|      ..|:..:.:||      
  Fly   219 ------QP--WTFVLFFILTSSFPSLSHLIKLRFVPVDVERF------FVDLMGSAVETRRAQLA 269

  Fly   294 AMRGFGKNDDGKTKCVLEQLLEHNKK------VAVTMVMDMLMAGIDTTSSACLTILYHLARNPS 352
            |.:.|.::|      .|:.:|:..:|      ..:...|..|:.|.:||::....||.:|.||..
  Fly   270 AGKQFERSD------FLDYILQLGEKRNLDNRQLLAYSMTFLLDGFETTATVLAHILLNLGRNKE 328

  Fly   353 KQEKLRRELLRILPTTKDSLTD-----QNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSG 412
            .|..||.|:       :..|.|     :...::|||.||::|.:|:  ..||   .....|....
  Fly   329 AQNLLREEI-------RSHLQDGTIAFEKLSDLPYLDACVQETIRL--FPPG---FMSNKLCTES 381

  Fly   413 YQVP----------RGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAART-RNP 466
            .::|          :||.|::.......|:::|.....|.|||:|:.|         ||:| |..
  Fly   382 IEIPNKEGPNFVVEKGTTVVVPHYCFMLDEEFFPNPQSFQPERFLEPD---------AAKTFRER 437

  Fly   467 FVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPET--PIEYE-STIILSPCGDIRFKL 528
            .|::.||.|||.|||.|.|.::|:..:|.|:..:.|....:|  ..:|| ..||....|.|...|
  Fly   438 GVFMGFGDGPRVCIGMRFATVQIKAAIVELISKFNVKINDKTRKDNDYEPGQIITGLRGGIWLDL 502

  Fly   529 E 529
            |
  Fly   503 E 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 112/500 (22%)
Cyp28a5NP_609694.1 p450 33..500 CDD:299894 118/515 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.