DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and Cyp28d1

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster


Alignment Length:459 Identity:112/459 - (24%)
Similarity:186/459 - (40%) Gaps:76/459 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 MGKPNAVFT------YNPDDFEMTYRNE----GVWPIRIG---LESLNY--------YRKIHRPD 143
            :|...:|||      |:.|:....|:|.    ||:..||.   :.:..|        :|..|..:
  Fly    43 VGSFPSVFTQKRNVVYDIDEIYEQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNE 107

  Fly   144 VFKGVGG-----LASD----QGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQ-- 197
            :.|....     ||::    .|:.|.:.|.:|.|.| ....|:...|...::.|:|::.:..|  
  Fly   108 MAKFTDSKTDPILANNPFVLTGEAWKERRAEVTPGL-SANRVKAAYPVSLRVCKKFVEYIRRQSL 171

  Fly   198 RNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDP---NADRLAKHMRDFFNYSFQFD 259
            ..|.......|.   ...:..|.||...|.......:|||.|   ...|:.:....|..|:...:
  Fly   172 MAPAQGLNAKDL---CLCYTTEVISDCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVAN 233

  Fly   260 VQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMR--GFGKNDDGKTKCVLEQLLEHNKKVAV 322
            :.|.|..||..:.|.|.:..:  ..|:....|:....  ...:.||     .|..:|:..:|..:
  Fly   234 LWPPITKFYSVSLFAKDVAAF--FYDLMQKCIQVRRESPAAQQRDD-----FLNYMLQLQEKKGL 291

  Fly   323 ------TMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMP 381
                  :..|..|..|.:||:......|..|||||.:|.|||.|:      ....||.:....:|
  Fly   292 NAAELTSHTMTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEI------GTAELTFEQISELP 350

  Fly   382 YLRACIKEGLRITS-------ITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSS 439
            :..|||.|.|||.|       :......:|.|:.|  ..::..|..|::.|..|.:|.:|:.:..
  Fly   351 FTEACIHETLRIFSPVLAARKVVTEPCELTNKNGV--SVKLRPGDVVIIPVNALHHDPQYYEEPQ 413

  Fly   440 EFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSW 504
            .|.|||:|..:..       |.:.|:..::..||.|||.|.|.|.:..:|:..||.::|::.:..
  Fly   414 SFKPERFLNINGG-------AKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKV 471

  Fly   505 LPET 508
            .|:|
  Fly   472 NPKT 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 112/459 (24%)
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 112/459 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.