DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and Cyp28d2

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster


Alignment Length:460 Identity:116/460 - (25%)
Similarity:191/460 - (41%) Gaps:78/460 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 MGKPNAVFT------YNPDDFEMTYRNE----GVWPIRIG---LESLNYYRKIHRPD-------- 143
            :|...::||      |:.||....|::.    ||:..|:.   :....|..||:..|        
  Fly    43 VGSFPSIFTRKRNIAYDIDDIYEKYKDTDNMVGVFTTRVPQLLVMCPEYIHKIYATDFRSFHNNE 107

  Fly   144 ----VFKGVGGLASDQ-----GQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRN 199
                |.|....:..:.     |.||.:.|:::.|.| ....|:...|....:.|:|::.:..|:.
  Fly   108 WRNFVNKKTDMILGNNPFVLTGDEWKERRSEIMPAL-SPNRVKAVYPVSQSVCKKFVEYIRRQQQ 171

  Fly   200 PETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQF---DVQ 261
            ..| :...|..:....:..|.:|...|.......:|.|.|    |.|.::..||.||:|   .|.
  Fly   172 MAT-SEGLDAMDLSLCYTTEVVSDCGLGVSAQSFTDTPTP----LLKMIKRVFNTSFEFIFYSVV 231

  Fly   262 PSIW----TFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLE----HNK 318
            .::|    .||....|.|..:.:  ..||....|...:....:..|.....:| ||.|    |..
  Fly   232 TNLWQKVRKFYSVPFFNKETEVF--FLDIIRRCITLRLEKPEQQRDDFLNYML-QLQEKKGLHTD 293

  Fly   319 KVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYL 383
            .:.:. .|..::.|.:||:.....|:..|.|||.:|:|:|:|:      ....||......:|:|
  Fly   294 NILIN-TMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEI------GSADLTFDQMSELPHL 351

  Fly   384 RACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTG----------VLMGVLELSNDDKYFAQS 438
            .|||.|.||:.|  |   ::..:.||...::.....|          |.:.|..|.:|.:|:...
  Fly   352 DACIYETLRLFS--P---QVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDP 411

  Fly   439 SEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVS 503
            ..|.|||:|:|:..    ...:.|.|.  |||.||.|||.|.|.|.|..:::..||.:||::::.
  Fly   412 LTFKPERFLESNGG----GMKSYRDRG--VYLAFGDGPRHCPGMRFALTQLKAALVEILRNFEIK 470

  Fly   504 WLPET 508
            ..|:|
  Fly   471 VNPKT 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 116/460 (25%)
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 115/458 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.