DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12b2 and Cyp26a1

DIOPT Version :9

Sequence 1:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_031837.2 Gene:Cyp26a1 / 13082 MGIID:1096359 Length:497 Species:Mus musculus


Alignment Length:208 Identity:59/208 - (28%)
Similarity:102/208 - (49%) Gaps:22/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 DGKTKCVLEQLLEHNKKVAVTMVM--------DMLMAGIDTTSSACLTILYHLARNPSKQEKLRR 359
            ||..|..|:.|:||:.:....:.|        ::|..|.:||:||..:::.:|...|...:|:|.
Mouse   264 DGGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVRE 328

  Fly   360 ELLR---ILPTTKDSLTDQNT-KNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTG 420
            |:..   :..:.:|:..|..| :.:.|....|||.||:....||.||:..|...|:|||:|:|..
Mouse   329 EIKSKGLLCKSNQDNKLDMETLEQLKYTGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWN 393

  Fly   421 VLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIA 485
            |:..:.:..:....|....||.|:|::          .|.....:.|.::|||.|.|:|:||..|
Mouse   394 VIYSICDTHDVADIFTNKEEFNPDRFI----------VPHPEDASRFSFIPFGGGLRSCVGKEFA 448

  Fly   486 ELEIETLLVRLLR 498
            ::.::...|.|.|
Mouse   449 KILLKIFTVELAR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 59/208 (28%)
Cyp26a1NP_031837.2 p450 43..491 CDD:299894 59/208 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.