DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-A and HS3ST1

DIOPT Version :9

Sequence 1:NP_001286589.1 Gene:Hs3st-A / 37161 FlyBaseID:FBgn0053147 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_005105.1 Gene:HS3ST1 / 9957 HGNCID:5194 Length:307 Species:Homo sapiens


Alignment Length:365 Identity:133/365 - (36%)
Similarity:188/365 - (51%) Gaps:108/365 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 TSRRLPQALIIGVRKCGTRALLEMLYLHPRIQKAGGEVHFFDRDENYLKGLEWYRKKMPHSFRGQ 302
            ::::|||.:||||||.|||||||||.|||.:..|..||||||.:|:|..||.||..:||.|:..|
Human    50 SAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQ 114

  Fly   303 ITIEKSPSYFVSPEVPERVRAMNASIKLLLIVREPVTRAISDYTQLRSHAATAILPLAEKDPPSP 367
            :|:||:|:||.||:|||||.:||.||:||||:|:|..|.:|||||                    
Human   115 LTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQ-------------------- 159

  Fly   368 RESSGGGAGGGGAGGGGGSGTAAAKMPTQSLLYAKLQSARGYDNALLGGSGAGAKETKGKTVSSS 432
                                          :.|..:|..:.|                 .::...
Human   160 ------------------------------VFYNHMQKHKPY-----------------PSIEEF 177

  Fly   433 LVRRQALGSGGGVAGAAMTTTTMSPMASAAQMAAKSFEELAIFPNGTVNEAYRPLSISMYHVHLH 497
            |||                                         :|.:|..|:.|:.|:||||:.
Human   178 LVR-----------------------------------------DGRLNVDYKALNRSLYHVHMQ 201

  Fly   498 RWLEVFPREQLLVVNGDRLIEDPVSQLKRIEAFLGIEHRVNSEHFYFNETKGFYCLRYDNGDRCL 562
            .||..||...:.:|:|||||.||..:::::|.||.:..::|:.:||||:||||||||....||||
Human   202 NWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCL 266

  Fly   563 RETKGRKHPHVDPVVVSRLRKFFAEYNQRFYELVGEDLGW 602
            .|:|||.||.|||.::::|.::|.|.|::|:||||....|
Human   267 HESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDW 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-ANP_001286589.1 Sulfotransfer_1 242..587 CDD:304426 125/344 (36%)
HS3ST1NP_005105.1 Sulfotransfer_1 54..291 CDD:279075 125/344 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522194at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10605
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5230
SonicParanoid 1 1.000 - - X2317
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.