DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-A and HS3ST2

DIOPT Version :9

Sequence 1:NP_001286589.1 Gene:Hs3st-A / 37161 FlyBaseID:FBgn0053147 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_006034.1 Gene:HS3ST2 / 9956 HGNCID:5195 Length:367 Species:Homo sapiens


Alignment Length:489 Identity:153/489 - (31%)
Similarity:210/489 - (42%) Gaps:149/489 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GVSRPKLAVVFLTVMLISLFLTFHVLYDSAVYNIQAAQAVHERHRL--------SMTASASALAS 187
            |..:|:.|...|....:||..|:      ..|:.........|.||        ..:|....|..
Human    10 GPPQPRRARRLLFAFTLSLSCTY------LCYSFLCCCDDLGRSRLLGAPRCLRGPSAGGQKLLQ 68

  Fly   188 SSSSSSNSGSSFSSAGGASNHLPVFVKPVP---SSNQLSHPMVFPSSRVHFPKTSRRLPQALIIG 249
            .|.....||.:.|.....|  .|....|.|   .||....|.:          .::|||||||:|
Human    69 KSRPCDPSGPTPSEPSAPS--APAAAVPAPRLSGSNHSGSPKL----------GTKRLPQALIVG 121

  Fly   250 VRKCGTRALLEMLYLHPRIQKAGGEVHFFDRDENYLKGLEWYRKKMPHSFRGQITIEKSPSYFVS 314
            |:|.||||:||.:.:||.::..|.|.|||||  ||.:||:|||..||.:...|||:||:|||||:
Human   122 VKKGGTRAVLEFIRVHPDVRALGTEPHFFDR--NYGRGLDWYRSLMPRTLESQITLEKTPSYFVT 184

  Fly   315 PEVPERVRAMNASIKLLLIVREPVTRAISDYTQLRSHAATAILPLAEKDPPSPRESSGGGAGGGG 379
            .|.|.|:..|:...||:::||.|||||||||||..|           |.|..|            
Human   185 QEAPRRIFNMSRDTKLIVVVRNPVTRAISDYTQTLS-----------KKPDIP------------ 226

  Fly   380 AGGGGGSGTAAAKMPTQSLLYAKLQSARGYDNALLGGSGAGAKETKGKTVSSSLVRRQALGSGGG 444
                                                                             
Human   227 ----------------------------------------------------------------- 226

  Fly   445 VAGAAMTTTTMSPMASAAQMAAKSFEELAIFPN---GTVNEAYRPLSISMYHVHLHRWLEVFPRE 506
                                   :||.|: |.|   |.|:.::..:.|.||.:||..||:.||..
Human   227 -----------------------TFEGLS-FRNRTLGLVDVSWNAIRIGMYVLHLESWLQYFPLA 267

  Fly   507 QLLVVNGDRLIEDPVSQLKRIEAFLGIEHRVNSEHFYFNETKGFYCLRYDNGD---RCLRETKGR 568
            |:..|:|:|||.||..::.|::.||||:..:..:|||||:||||.||:.....   |||.::|||
Human   268 QIHFVSGERLITDPAGEMGRVQDFLGIKRFITDKHFYFNKTKGFPCLKKTESSLLPRCLGKSKGR 332

  Fly   569 KHPHVDPVVVSRLRKFFAEYNQRFYELVGEDLGW 602
            .|..:||.|:.:||:|:..||.:|||.||:|..|
Human   333 THVQIDPEVIDQLREFYRPYNIKFYETVGQDFRW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-ANP_001286589.1 Sulfotransfer_1 242..587 CDD:304426 119/350 (34%)
HS3ST2NP_006034.1 cytoplasmic domain 1..19 3/8 (38%)
transmembrane domain 20..41 5/26 (19%)
sulfotransferase domain 110..367 129/371 (35%)
Sulfotransfer_1 114..351 CDD:395556 119/350 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.