DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-A and hs3st1l1

DIOPT Version :9

Sequence 1:NP_001286589.1 Gene:Hs3st-A / 37161 FlyBaseID:FBgn0053147 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001074908.1 Gene:hs3st1l1 / 557111 ZFINID:ZDB-GENE-070202-2 Length:309 Species:Danio rerio


Alignment Length:390 Identity:139/390 - (35%)
Similarity:189/390 - (48%) Gaps:115/390 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PVPS--SNQLSHPMVFPSSRVHFPKTSRRLPQALIIGVRKCGTRALLEMLYLHPRIQKAGGEVHF 277
            |.|.  ||....|.:.|.     |.:|:..|.::||||||.|||||||||.:||.:..|..||||
Zfish    32 PAPGDPSNDSVTPSLIPP-----PGSSKHPPHSIIIGVRKGGTRALLEMLDIHPEVAAAATEVHF 91

  Fly   278 FDRDENYLKGLEWYRKKMPHSFRGQITIEKSPSYFVSPEVPERVRAMNASIKLLLIVREPVTRAI 342
            ||.||||.||.:|||::||:|:..||||||:|.||.|...|.|:.|||:||:||||:|:|..|.|
Zfish    92 FDWDENYSKGFDWYREQMPYSYPTQITIEKTPGYFTSQVAPARIHAMNSSIRLLLILRDPTERVI 156

  Fly   343 SDYTQLRSHAATAILPLAEKDPPSPRESSGGGAGGGGAGGGGGSGTAAAKMPTQSLLYAKLQSAR 407
            |||||:                                                           
Zfish   157 SDYTQV----------------------------------------------------------- 162

  Fly   408 GYDNALLGGSGAGAKETKGKTVSSSLVRRQALGSGGGVAGAAMTTTTMSPMASAAQMAAKSFEEL 472
             |.|.|                                       ....|:.:...|..|     
Zfish   163 -YFNRL---------------------------------------ENHKPVQAIENMLVK----- 182

  Fly   473 AIFPNGTVNEAYRPLSISMYHVHLHRWLEVFPREQLLVVNGDRLIEDPVSQLKRIEAFLGIEHRV 537
                ||.:|..|:.:..|:|.||:..||:.||.||:.:|:||.||.||:.:|:|:|.||.:..|:
Zfish   183 ----NGALNTRYKAIQRSLYDVHMRNWLQHFPLEQIHIVDGDTLIHDPLPELQRVERFLDLPPRI 243

  Fly   538 NSEHFYFNETKGFYCLRYDNGDRCLRETKGRKHPHVDPVVVSRLRKFFAEYNQRFYELVGEDLGW 602
            .:.:||||:||||||:|.|..:|||.|:|||.||.|:..|:.:||.:..::|:.||.|:|....|
Zfish   244 EASNFYFNQTKGFYCIRSDGHERCLHESKGRPHPPVNSNVLRQLRSYLRQHNRNFYRLIGRTFNW 308

  Fly   603  602
            Zfish   309  308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-ANP_001286589.1 Sulfotransfer_1 242..587 CDD:304426 125/344 (36%)
hs3st1l1NP_001074908.1 Sulfotransfer_1 56..258 CDD:279075 108/309 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522194at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5230
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.