DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-A and NDST1

DIOPT Version :9

Sequence 1:NP_001286589.1 Gene:Hs3st-A / 37161 FlyBaseID:FBgn0053147 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001534.1 Gene:NDST1 / 3340 HGNCID:7680 Length:882 Species:Homo sapiens


Alignment Length:383 Identity:89/383 - (23%)
Similarity:145/383 - (37%) Gaps:119/383 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 KTSRRLPQALIIGVRKCGTRALLEMLYLHPRI------QKAGGEVHFFDRDENYLKGLEWYRK-- 293
            ||..|.|:.||||.:|.||.||...|.:||.:      .:...|:.||: ..||.||::||.:  
Human   599 KTCDRFPKLLIIGPQKTGTTALYLFLGMHPDLSSNYPSSETFEEIQFFN-GHNYHKGIDWYMEFF 662

  Fly   294 KMPHSFRGQITIEKSPSYFVSPEVPERVRAMNASIKLLLIVREPVTRAISDYTQLRSHAATAILP 358
            .:|.:.......|||.:||.|...|.|..|:....|:|.|:..|..||.|.|...|:|       
Human   663 PIPSNTTSDFYFEKSANYFDSEVAPRRAAALLPKAKVLTILINPADRAYSWYQHQRAH------- 720

  Fly   359 LAEKDPPSPRESSGGGAGGGGAGGGGGSGTAAAKMPTQSLLYAKLQSARGYDNALLGGSGAGAKE 423
                |.|                              .:|.|.       :...:..||.|.:| 
Human   721 ----DDP------------------------------VALKYT-------FHEVITAGSDASSK- 743

  Fly   424 TKGKTVSSSLVRRQALGSGGGVAGAAMTTTTMSPMASAAQMAAKSFEELAIFPNGTVNEAYRPLS 488
                                                      .::.:...:.|            
Human   744 ------------------------------------------LRALQNRCLVP------------ 754

  Fly   489 ISMYHVHLHRWLEVFPREQLLVVNGDRLIEDPVSQLKRIEAFLGIEHRVN-SEHFYFNETKGFYC 552
             ..|..|:.|||..:...|:||::|..|..:|...:..::.|||:.:.:: .:...|:..|||:|
Human   755 -GWYATHIERWLSAYHANQILVLDGKLLRTEPAKVMDMVQKFLGVTNTIDYHKTLAFDPKKGFWC 818

  Fly   553 LRYDNG-DRCLRETKGRKHPHVDPVVVSRLRKFFAEYNQRFYEL---VGEDL-GWPEE 605
            ...:.| .:||.::||||:|.:|....:.|:.::.::|....:|   :|:.| .|..|
Human   819 QLLEGGKTKCLGKSKGRKYPEMDLDSRAFLKDYYRDHNIELSKLLYKMGQTLPTWLRE 876

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-ANP_001286589.1 Sulfotransfer_1 242..587 CDD:304426 80/354 (23%)
NDST1NP_001534.1 HSNSD 30..515 CDD:288882
Heparan sulfate N-deacetylase 1 40..598
Heparan sulfate N-sulfotransferase 1 599..882 89/383 (23%)
Sulfotransfer_1 605..855 CDD:279075 80/354 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.