DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs3st-A and Hs3st4

DIOPT Version :9

Sequence 1:NP_001286589.1 Gene:Hs3st-A / 37161 FlyBaseID:FBgn0053147 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_017445955.2 Gene:Hs3st4 / 108349781 RGDID:11422907 Length:449 Species:Rattus norvegicus


Alignment Length:372 Identity:134/372 - (36%)
Similarity:184/372 - (49%) Gaps:120/372 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 RRLPQALIIGVRKCGTRALLEMLYLHPRIQKAGGEVHFFDRDENYLKGLEWYRKKMPHSFRGQIT 304
            ::|||||||||:|.|||||||.:.:||.::..|.|.|||||  ||.|||||||..||.:..||||
  Rat   188 KKLPQALIIGVKKGGTRALLEAIRVHPDVRAVGVEPHFFDR--NYEKGLEWYRNVMPKTLDGQIT 250

  Fly   305 IEKSPSYFVSPEVPERVRAMNASIKLLLIVREPVTRAISDYTQLRSHAATAILPLAEKDPPSPRE 369
            :||:|||||:.|.|:|:.:|...|||:::||.|||||||||||..|           |.|..|  
  Rat   251 MEKTPSYFVTNEAPKRIHSMAKDIKLIVVVRNPVTRAISDYTQTLS-----------KKPEIP-- 302

  Fly   370 SSGGGAGGGGAGGGGGSGTAAAKMPTQSLLYAKLQSARGYDNALLGGSGAGAKETKGKTVSSSLV 434
                                                                             
  Rat   303 ----------------------------------------------------------------- 302

  Fly   435 RRQALGSGGGVAGAAMTTTTMSPMASAAQMAAKSFEELAIFPN---GTVNEAYRPLSISMYHVHL 496
                                             :||.|| |.|   |.::.::..:.|.:|.:||
  Rat   303 ---------------------------------TFEVLA-FKNRTLGLIDASWSAIRIGIYALHL 333

  Fly   497 HRWLEVFPREQLLVVNGDRLIEDPVSQLKRIEAFLGIEHRVNSEHFYFNETKGFYCLRY---DNG 558
            ..||:.||..|:|.|:|:|||.||..::.:::.|||::..|..:|||||:||||.||:.   .:.
  Rat   334 ENWLQYFPLSQILFVSGERLIVDPAGEMAKVQDFLGLKRVVTEKHFYFNKTKGFPCLKKPEDSSA 398

  Fly   559 DRCLRETKGRKHPHVDPVVVSRLRKFFAEYNQRFYELVGEDLGWPEE 605
            .|||.::|||.||.:||.|:.|||||:..:|..||::.|:|..|.:|
  Rat   399 PRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNMMFYQMTGQDFQWEQE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs3st-ANP_001286589.1 Sulfotransfer_1 242..587 CDD:304426 127/350 (36%)
Hs3st4XP_017445955.2 Sulfotransfer_1 190..427 CDD:395556 127/350 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D712400at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.