DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELO1

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_012339.1 Gene:ELO1 / 853243 SGDID:S000003732 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:70/268 - (26%)
Similarity:120/268 - (44%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKK---- 85
            |.|.::.:..|.::||. |...::|.||..:|....::|   :::.|..||.  ..|.:::    
Yeast    62 PRPVLLFIAMYYVVIFG-GRSLVKSCKPLKLRFISQVHN---LMLTSVSFLW--LILMVEQMLPI 120

  Fly    86 -----LYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVF 145
                 || |....:.|...|.:    .|.|..::.|.::..||:..||:  ::::|.||.|||..
Yeast   121 VYRHGLY-FAVCNVESWTQPME----TLYYLNYMTKFVEFADTVLMVLK--HRKLTFLHTYHHGA 178

  Fly   146 MVLGVPLTYYFYGPGGQYNLMGY---------LNSFVHVVMYAYYFASAWYPNVKSTFWWKEYIT 201
            ..|   |.|        ..|:||         ||..|||:||.|||.||....|    |||.::|
Yeast   179 TAL---LCY--------NQLVGYTAVTWVPVTLNLAVHVLMYWYYFLSASGIRV----WWKAWVT 228

  Fly   202 KLQFLQFMI-------LFAQSVLTLWLNPGCRFPKV------LQYVQLGGSV--SMMTMFGNFYY 251
            :||.:|||:       :..|.::..:....|. |:.      :..:..|.::  |.:.:|.:||.
Yeast   229 RLQIVQFMLDLIVVYYVLYQKIVAAYFKNACT-PQCEDCLGSMTAIAAGAAILTSYLFLFISFYI 292

  Fly   252 QTYVKAKS 259
            :.|.:..:
Yeast   293 EVYKRGSA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 70/268 (26%)
ELO1NP_012339.1 ELO 58..303 CDD:395916 70/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I1570
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9158
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.