DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELO2

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_009963.1 Gene:ELO2 / 850400 SGDID:S000000630 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:81/280 - (28%)
Similarity:122/280 - (43%) Gaps:75/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSR-KPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLF 82
            ||:...| |.:..:..|.::||  |..|:.|: ||:.:.....::|.  ||.:..:.|:   .|.
Yeast    63 LPLSTLP-PVLYAITAYYVIIF--GGRFLLSKSKPFKLNGLFQLHNL--VLTSLSLTLL---LLM 119

  Fly    83 IKKLYD--------FRCMTMLSSDHPDKDVDRLLTYFY--FINKVIDLIDTIFFVLRKSNKQITV 137
            :::|..        |....:.:...|      |:|.:|  :|.|.|:.|||.|.||:  :|::|.
Yeast   120 VEQLVPIIVQHGLYFAICNIGAWTQP------LVTLYYMNYIVKFIEFIDTFFLVLK--HKKLTF 176

  Fly   138 LHVYHHVFMVLGVPLTYYFYGPGGQYNLMG---------YLNSFVHVVMYAYYFASAWYPNVKST 193
            ||.|||....|   |.|        ..|||         .||..||||||.|||.:|....|   
Yeast   177 LHTYHHGATAL---LCY--------TQLMGTTSISWVPISLNLGVHVVMYWYYFLAARGIRV--- 227

  Fly   194 FWWKEYITKLQFLQFM-----ILFA--QSVLTLWLNPGCRFPKVLQYVQLGGSV----------- 240
             ||||::|:.|.:||:     |.||  |..:.|:      ||.:.......||.           
Yeast   228 -WWKEWVTRFQIIQFVLDIGFIYFAVYQKAVHLY------FPILPHCGDCVGSTTATFAGCAIIS 285

  Fly   241 SMMTMFGNFYYQTYVKAKSK 260
            |.:.:|.:||...|.:..:|
Yeast   286 SYLVLFISFYINVYKRKGTK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 80/279 (29%)
ELO2NP_009963.1 ELO 64..307 CDD:395916 80/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I1570
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9158
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.