DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl4

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:256 Identity:90/256 - (35%)
Similarity:146/256 - (57%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIF---LMGTY-- 79
            |:..:|.|.|.|...|||.:: :||.:|:.|:|:.||..::||||..||:|..||   .||:|  
Mouse    41 PLMQSPWPTISISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNA 104

  Fly    80 -YLFIKKLYDFRCMTMLSSDHPDKDVDRL----LTYFYFINKVIDLIDTIFFVLRKSNKQITVLH 139
             |.:|.:..|:           ..||:.:    ..::||::|.::.:||:||:|||.|.|::.||
Mouse   105 GYSYICQSVDY-----------SNDVNEVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSFLH 158

  Fly   140 VYHHVFMVLGVPLTYYFYG----PGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYI 200
            ||||..|     .|.::.|    .|||......:|||:||:||:||..:|:.|.::...|||.|:
Mouse   159 VYHHCTM-----FTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYL 218

  Fly   201 TKLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKE 261
            |.||.:||.:....:.|:|:.:  |.|||.:.:..:..::|.:.:|.|||.:||.:.|..:
Mouse   219 TMLQLVQFHVTIGHTALSLYTD--CPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKQSK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 90/256 (35%)
Elovl4NP_683743.2 ELO 41..277 CDD:279492 90/254 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 1/5 (20%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.