DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELOVL3

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:282 Identity:83/282 - (29%)
Similarity:131/282 - (46%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFTLLDLFRGLPADPVHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQ 66
            ||.|....|     |.....:.|..|   |.|.||:|| .||.::|:.||.:|::..:::::||.
Human    19 NFELSKDMR-----PFFEEYWATSFP---IALIYLVLI-AVGQNYMKERKGFNLQGPLILWSFCL 74

  Fly    67 VLMNS-------GIFLMGTYYLF--IKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLID 122
            .:.:.       ||  |||..|.  :|:       |:...:..|....:..::.:.::|||:|.|
Human    75 AIFSILGAVRMWGI--MGTVLLTGGLKQ-------TVCFINFIDNSTVKFWSWVFLLSKVIELGD 130

  Fly   123 TIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWY 187
            |.|.:|||  :.:..:|.|||..:::.....|....|.|.:.:.  :|..||.:||.||...|  
Human   131 TAFIILRK--RPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVT--MNFGVHAIMYTYYTLKA-- 189

  Fly   188 PNVKSTFWWKEYITKLQFLQFMILFAQSVLT-LW-LNPGCR------FPKVLQYVQLGGSVSMMT 244
            .|||........||.||.||..:....|:|| :| .:.||.      |...:.|      ::...
Human   190 ANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILY------MTYFI 248

  Fly   245 MFGNFYYQTY----VKAKSKEQ 262
            :|.:|:.|||    ||||:|.|
Human   249 LFAHFFCQTYIRPKVKAKTKSQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 77/262 (29%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 74/261 (28%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2489
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.670

Return to query results.
Submit another query.