powered by:
Protein Alignment CG17821 and HOS3-1
DIOPT Version :9
Sequence 1: | NP_725820.2 |
Gene: | CG17821 / 37159 |
FlyBaseID: | FBgn0034383 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001329164.1 |
Gene: | HOS3-1 / 829836 |
AraportID: | AT4G36830 |
Length: | 308 |
Species: | Arabidopsis thaliana |
Alignment Length: | 75 |
Identity: | 18/75 - (24%) |
Similarity: | 38/75 - (50%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 TYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLN-SF 172
:|.:::.:.:.:..|||.||| ::::.|..::.:..|.....|...| ...|.::..|: :.
plant 133 SYVFYLTRFLHMFRTIFAVLR--SRRLAVSQLFCNSVMAFTSFLWLEF---SQSYQILAILSTTL 192
Fly 173 VHVVMYAYYF 182
|:.|:|.|.|
plant 193 VYSVVYGYRF 202
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG17821 | NP_725820.2 |
ELO |
20..262 |
CDD:279492 |
18/75 (24%) |
HOS3-1 | NP_001329164.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1094172at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.