DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and HOS3-1

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:75 Identity:18/75 - (24%)
Similarity:38/75 - (50%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLN-SF 172
            :|.:::.:.:.:..|||.|||  ::::.|..::.:..|.....|...|   ...|.::..|: :.
plant   133 SYVFYLTRFLHMFRTIFAVLR--SRRLAVSQLFCNSVMAFTSFLWLEF---SQSYQILAILSTTL 192

  Fly   173 VHVVMYAYYF 182
            |:.|:|.|.|
plant   193 VYSVVYGYRF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 18/75 (24%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.