DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and AT3G06470

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_187298.1 Gene:AT3G06470 / 819824 AraportID:AT3G06470 Length:278 Species:Arabidopsis thaliana


Alignment Length:281 Identity:68/281 - (24%)
Similarity:112/281 - (39%) Gaps:95/281 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VIVLGYLLLIF--KVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKKLYDFRCM 92
            |:|..||...|  :...|.:.|..|..::....:::....|: |.:..:|             |.
plant    38 VVVSVYLSATFLLRSAIDSLPSLSPRILKPITAVHSLILCLL-SLVMAVG-------------CT 88

  Fly    93 TMLSSDHPDKD-VDRLL--------------TYF----YFINKVIDLIDTIFFVLRKSNKQITVL 138
            ..::|.|...| :.|.|              .:|    ::::|:::..|||..:|.||.::::.|
plant    89 LSITSSHASSDPMARFLHAICFPVDVKPNGPLFFWAQVFYLSKILEFGDTILIILGKSIQRLSFL 153

  Fly   139 HVYHHVFMVLGVPLTYYFYGPGGQYNLMGYL---------------NSFVHVVMYAYYFASAWYP 188
            |||||..:|                 :|.||               ||.|||:||.|||..|   
plant   154 HVYHHATVV-----------------VMCYLWLRTRQSMFPIALVTNSTVHVIMYGYYFLCA--- 198

  Fly   189 NVKSTFWWKEYITKLQFLQFMILFAQSVLTLWL------NPGCRFPKVLQYVQLGG-------SV 240
             |.|...||..:|..|.:||:..|.   |:.|:      ..||        ..:.|       :.
plant   199 -VGSRPKWKRLVTDCQIVQFVFSFG---LSGWMLREHLFGSGC--------TGIWGWCFNAAFNA 251

  Fly   241 SMMTMFGNFYYQTYVKAKSKE 261
            |::.:|.||:.:.|||..::|
plant   252 SLLALFSNFHSKNYVKKPTRE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 68/281 (24%)
AT3G06470NP_187298.1 ELO 43..272 CDD:395916 65/274 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3313
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.