DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELOVL7

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001098028.1 Gene:ELOVL7 / 79993 HGNCID:26292 Length:281 Species:Homo sapiens


Alignment Length:274 Identity:94/274 - (34%)
Similarity:140/274 - (51%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FRGLPADPVHL---------P------MFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKA 58
            |..|.:..|||         |      :..:|||..:::..|:..:..:||..|.:|||:.::||
Human     3 FSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKA 67

  Fly    59 MLIYNFCQVLMNSGIFLMGTYYLFIKK----LYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVID 119
            |:.|||..||     |.:...|.|:..    .|.|||..:..|..|.........:.|:.:|.|:
Human    68 MITYNFFIVL-----FSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIE 127

  Fly   120 LIDTIFFVLRKSNKQITVLHVYHHVFMVLGVPLTYYF---YGPGGQYNLMGYLNSFVHVVMYAYY 181
            |:|||||||||.|.|:|.|||:||..|    |.|::|   :..||.......||:.||||||:||
Human   128 LLDTIFFVLRKKNSQVTFLHVFHHTIM----PWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYY 188

  Fly   182 FASAWYPNVKSTFWWKEYITKLQFLQFMILFAQSVLTLWLNPGCR--FPKVLQYVQLGGSVSMMT 244
            ..||..|..:...|||:|:|.||.:||:|: |..:...:....|:  || |...:.:..|...:.
Human   189 GLSALGPAYQKYLWWKKYLTSLQLVQFVIV-AIHISQFFFMEDCKYQFP-VFACIIMSYSFMFLL 251

  Fly   245 MFGNFYYQTYVKAK 258
            :|.:|:|:.|.|.:
Human   252 LFLHFWYRAYTKGQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 89/254 (35%)
ELOVL7NP_001098028.1 ELO 30..269 CDD:307345 88/247 (36%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.