DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl7

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_083277.3 Gene:Elovl7 / 74559 MGIID:1921809 Length:281 Species:Mus musculus


Alignment Length:253 Identity:86/253 - (33%)
Similarity:138/253 - (54%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGI---FLM---GTY 79
            :..:|||..:|:..|:..:..:||..|.:|||:.::|||:.|||..||.:..:   |:|   ||.
Mouse    30 LMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGTG 94

  Fly    80 YLFIKKLYDF----RCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHV 140
            |.|...:.|:    |.|.|:.:           .:.|:.:|.|:|:|||||||||.|.|:|.|||
Mouse    95 YSFRCDIVDYSQSPRAMRMVHT-----------CWLYYFSKFIELLDTIFFVLRKKNSQVTFLHV 148

  Fly   141 YHHVFMVLGVPLTYYF---YGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITK 202
            :||..|    |.|::|   :..||......:||:.||||||:||...|..|..:...|||:::|.
Mouse   149 FHHTIM----PWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTS 209

  Fly   203 LQFLQFMILFAQSVLTLWLNPGC--RFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAK 258
            ||.:|| :|....:..::....|  ::|..|..:...|.:.:: :|.:|:|:.|.|.:
Mouse   210 LQLVQF-VLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLL-LFLHFWYRAYTKGQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 86/253 (34%)
Elovl7NP_083277.3 ELO 30..269 CDD:279492 86/253 (34%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.