DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl5

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_030100414.1 Gene:Elovl5 / 68801 MGIID:1916051 Length:340 Species:Mus musculus


Alignment Length:246 Identity:87/246 - (35%)
Similarity:143/246 - (58%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKKL---- 86
            :|..|..:.|||::: :||.:|::|:|::.|..:.:||.       |:.|: :.|:|.:.:    
Mouse    74 IPTFVCSVIYLLIVW-LGPKYMKNRQPFSCRGILQLYNL-------GLTLL-SLYMFYELVTGVW 129

  Fly    87 ---YDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHV---- 144
               |:|.|....|:...|..:.|:|.::|| :|:|:.:||.||:|||:|.||||||||||.    
Mouse   130 EGKYNFFCQGTRSAGESDMKIIRVLWWYYF-SKLIEFMDTFFFILRKNNHQITVLHVYHHATMLN 193

  Fly   145 ---FMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFL 206
               |::..||..:.::|        ..||||:||:||:||..|: .|:::...|||:|||:.|.:
Mouse   194 IWWFVMNWVPCGHSYFG--------ATLNSFIHVLMYSYYGLSS-IPSMRPYLWWKKYITQGQLV 249

  Fly   207 QFMILFAQSVL-TLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVK 256
            ||::...|:.. ..|   .|.||....:.|:|..:|::.:|.|||.|||.|
Mouse   250 QFVLTIIQTTCGVFW---PCSFPLGWLFFQIGYMISLIALFTNFYIQTYNK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 87/246 (35%)
Elovl5XP_030100414.1 ELO 68..302 CDD:366492 87/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.