DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl1

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:266 Identity:86/266 - (32%)
Similarity:151/266 - (56%) Gaps:22/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLDLFRGLP--ADP--VHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFC 65
            :::|::.|.  |||  .:.|:.|:||....|:|.|:..:..:||..|.:|||:.:|..|::|||.
  Rat     4 VVNLYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFS 68

  Fly    66 QVLMNSGI---FLMGTYYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFV 127
            .|.::..|   |||..:.    ..|.:||..:..|::|:......:.:.:.::|||:|:||:.|:
  Rat    69 LVTLSLYIVYEFLMSGWL----STYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIFI 129

  Fly   128 LRKSNKQITVLHVYHHVFMVLGVPLTYYF---YGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPN 189
            |||.:.|:|.|||:||..:    |.::::   ..|||..:....:||.||||||.||..||..|.
  Rat   130 LRKKDGQVTFLHVFHHSVL----PWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPV 190

  Fly   190 VKSTFWWKEYITKLQFLQFMILFAQSVLTLWLNPGC--RFPKVLQYVQLGGSVSMMTMFGNFYYQ 252
            .:...|||:::|.:|.:|| :|.:..:...:..|.|  ::|.::..:.:.|:: ...:|.||:|.
  Rat   191 AQPYLWWKKHMTAIQLIQF-VLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTI-FFILFSNFWYH 253

  Fly   253 TYVKAK 258
            :|.|.|
  Rat   254 SYTKGK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 81/247 (33%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.