DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elovl2

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005162628.1 Gene:elovl2 / 678614 ZFINID:ZDB-GENE-060421-5612 Length:295 Species:Danio rerio


Alignment Length:248 Identity:84/248 - (33%)
Similarity:136/248 - (54%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKKL----- 86
            |..::.:.|||.|: :|..:||:|..|:::..:|:|||...::        ::|:.::.:     
Zfish    37 PTFLLTITYLLTIY-LGTKYMRNRPAYSLKNVLLLYNFSVTVL--------SFYMLVELISAVWS 92

  Fly    87 --YDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFM--- 146
              |..:|..:......|..|.::|.::|| :|:|:.:||||.||||.|.||:.||||||..|   
Zfish    93 AGYRLQCQALDEVGEADIRVAKVLWWYYF-SKLIEFLDTIFIVLRKKNSQISFLHVYHHASMFNI 156

  Fly   147 ---VLG-VPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFLQ 207
               ||. :|....|:||        .||||:||:||:|| ..|..|::....|||.|:|:.|.:|
Zfish   157 WWCVLNWIPCGQSFFGP--------TLNSFIHVLMYSYY-GLATIPSMHKYLWWKRYLTQAQLVQ 212

  Fly   208 FMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSK 260
            |::....:| :.|:.| |.||......|.....:::.:|.|||.|||.|.|::
Zfish   213 FVLTITHTV-SAWVVP-CGFPLGCLKFQTFYMCTLVVLFVNFYIQTYKKRKTE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 84/248 (34%)
elovl2XP_005162628.1 ELO 31..262 CDD:279492 83/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.