DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELOVL4

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens


Alignment Length:246 Identity:88/246 - (35%)
Similarity:144/246 - (58%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIF---LMGTYYL 81
            |:..:|.|.:.|...|||.:: :||.:|:.|:|:.||..::||||..||:|..||   .||:|  
Human    41 PLMQSPWPTLSISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSY-- 102

  Fly    82 FIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFM 146
              ...|.:.|.::..|::..:.......::||::|.::.:||:||:|||.|.|::.||||||..|
Human   103 --NAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTM 165

  Fly   147 VLGVPLTYYFYG----PGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFLQ 207
                 .|.::.|    .|||......||||:||:||:||..:|:.|.::...|||.|:|.||.:|
Human   166 -----FTLWWIGIKWVAGGQAFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQ 225

  Fly   208 FMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAK 258
            |.:....:.|:|:.:  |.|||.:.:..:..::|.:.:|.|||.:||.:.|
Human   226 FHVTIGHTALSLYTD--CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 88/246 (36%)
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 88/246 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 88/246 (36%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.