DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELOVL5

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:272 Identity:88/272 - (32%)
Similarity:141/272 - (51%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKK----- 85
            :|..:..:.|||::: :||.:||:::|::.|..:::||.       |:.|:..|.....|     
Human    33 IPTFICSVIYLLIVW-LGPKYMRNKQPFSCRGILVVYNL-------GLTLLSLYMFCESKREQPR 89

  Fly    86 ----------------------------LYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLID 122
                                        .|:|.|....::...|..:.|:|.::|| :|:|:.:|
Human    90 RSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYF-SKLIEFMD 153

  Fly   123 TIFFVLRKSNKQITVLHVYHHV-------FMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAY 180
            |.||:|||:|.||||||||||.       |::..||..:.::|        ..||||:||:||:|
Human   154 TFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFG--------ATLNSFIHVLMYSY 210

  Fly   181 YFASAWYPNVKSTFWWKEYITKLQFLQFMILFAQ-SVLTLWLNPGCRFPKVLQYVQLGGSVSMMT 244
            |..|: .|:::...|||:|||:.|.|||::...| |...:|   .|.||....|.|:|..:|::.
Human   211 YGLSS-VPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIW---PCTFPLGWLYFQIGYMISLIA 271

  Fly   245 MFGNFYYQTYVK 256
            :|.|||.|||.|
Human   272 LFTNFYIQTYNK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 88/272 (32%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 88/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.