DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and ELOVL2

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011513018.1 Gene:ELOVL2 / 54898 HGNCID:14416 Length:326 Species:Homo sapiens


Alignment Length:254 Identity:86/254 - (33%)
Similarity:136/254 - (53%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKK 85
            |..:.||...:.:.|||.|: :|..:|::|...::|..:.:||.       ||.|:..|.|....
Human    61 MLDSYLPTFFLTVMYLLSIW-LGNKYMKNRPALSLRGILTLYNL-------GITLLSAYMLAELI 117

  Fly    86 L------YDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHV 144
            |      |:.:|..:.|:...|..|.::|.::|| :|.::.:|||||||||...|||.||||||.
Human   118 LSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYF-SKSVEFLDTIFFVLRKKTSQITFLHVYHHA 181

  Fly   145 FM------VLG-VPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITK 202
            .|      ||. :|....|:||        .||||:|::||:||..|. :|::....|||:|:|:
Human   182 SMFNIWWCVLNWIPCGQSFFGP--------TLNSFIHILMYSYYGLSV-FPSMHKYLWWKKYLTQ 237

  Fly   203 LQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKE 261
            .|.:||::....::..: :.| |.||......|....::::.:|.|||.|||.|...|:
Human   238 AQLVQFVLTITHTMSAV-VKP-CGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 86/254 (34%)
ELOVL2XP_011513018.1 ELO 60..294 CDD:279492 85/252 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.