DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and elovl2

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001016159.1 Gene:elovl2 / 548913 XenbaseID:XB-GENE-489753 Length:296 Species:Xenopus tropicalis


Alignment Length:254 Identity:87/254 - (34%)
Similarity:137/254 - (53%) Gaps:35/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKK 85
            |..:.||.:.:.|.|.|.|: :|..:|::|..:::|..:::||....|:        :.|:.|:.
 Frog    31 MLDSYLPTLFLTLLYFLSIW-LGTKYMQNRPAFSLRGHLIVYNLVVTLL--------SLYMLIEL 86

  Fly    86 L-------YDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHH 143
            :       |:.:|..:.|:...|..|.::|.::|| :|.|:.:|||||||||.|.|||.||||||
 Frog    87 ILSTWEGGYNLQCQNLDSAGKADVRVAKVLWWYYF-SKAIEFMDTIFFVLRKKNSQITFLHVYHH 150

  Fly   144 VFM------VLG-VPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYIT 201
            ..|      ||. :|....|:||        .||||:||:||:||..|. .|::....|||.|:|
 Frog   151 ASMFNIWWCVLNWIPCGQSFFGP--------TLNSFIHVLMYSYYGLSV-IPSMHKYLWWKRYLT 206

  Fly   202 KLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSK 260
            :.|.:||::....: |:..:.| |.||......|.....:::.:|.|||.:||.|..||
 Frog   207 QAQLVQFLLTITHT-LSAAVKP-CGFPFGCLMFQASYMATLVILFVNFYLKTYKKRPSK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 87/254 (34%)
elovl2NP_001016159.1 ELO 49..263 CDD:366492 79/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.