DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl1

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001034265.1 Gene:Elovl1 / 54325 MGIID:1858959 Length:279 Species:Mus musculus


Alignment Length:255 Identity:85/255 - (33%)
Similarity:143/255 - (56%) Gaps:20/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ADP--VHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGI--- 73
            |||  ...|:.|:||....|:|.|:..|..:||..|.:|||:.:|..|::|||..|:::..|   
Mouse    15 ADPRIQSYPLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRGFMIVYNFSLVILSLYIVYE 79

  Fly    74 FLMGTYYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVL 138
            |||..:.    ..|.:||..:..|:.|:......:.:.:.::|||:|:||:.|:|||.:.|:|.|
Mouse    80 FLMSGWL----STYTWRCDPIDFSNSPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVTFL 140

  Fly   139 HVYHHVFMVLGVPLTYYF---YGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYI 200
            ||:||..:    |.::::   ..|||..:....:||.||||||.||..||..|..:...|||:::
Mouse   141 HVFHHSVL----PWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHM 201

  Fly   201 TKLQFLQFMILFAQSVLTLWLNPGC--RFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAK 258
            |.:|.:|| :|.:..:...:..|.|  ::|.::..:.:.|:: ...:|.||:|.:|.|.|
Mouse   202 TAIQLIQF-VLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTI-FFILFSNFWYHSYTKGK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 82/247 (33%)
Elovl1NP_001034265.1 ELO 23..260 CDD:366492 82/247 (33%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.