DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17821 and Elovl2

DIOPT Version :9

Sequence 1:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038951934.1 Gene:Elovl2 / 498728 RGDID:1308605 Length:296 Species:Rattus norvegicus


Alignment Length:250 Identity:86/250 - (34%)
Similarity:136/250 - (54%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIFLMGTYYLFIKKL---- 86
            ||...:.:.|||.|: :|..:|::|...::|..:.:||.       ||.|:..|.|....|    
  Rat    36 LPTFTLTIVYLLSIW-LGNKYMKNRPALSLRGILTLYNL-------GITLLSAYMLVELVLSSWE 92

  Fly    87 --YDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQITVLHVYHHVFM--- 146
              |:.:|..:.|:...|..|.::|.::|| :|:::.:|||||||||...|||.||||||..|   
  Rat    93 GGYNLQCQNLDSAGEGDIRVAKVLWWYYF-SKLVEFLDTIFFVLRKKTSQITFLHVYHHASMFNI 156

  Fly   147 ---VLG-VPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYITKLQFLQ 207
               ||. :|....|:||        .||||:|::||:||..|. :|::....|||:|:|:.|.:|
  Rat   157 WWCVLNWIPCGQSFFGP--------TLNSFIHILMYSYYGLSV-FPSMHRYLWWKKYLTQAQLVQ 212

  Fly   208 FMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKEQ 262
            |::....: |:..:.| |.||......|....::::.:|.|||.|||.|...|::
  Rat   213 FVLTITHT-LSAVVKP-CGFPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPMKKE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 86/248 (35%)
Elovl2XP_038951934.1 ELO 30..264 CDD:395916 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.